Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF2/- |
Location | 2111326..2111625 | Replicon | chromosome |
Accession | NZ_CP033112 | ||
Organism | Staphylococcus aureus strain ST20130944 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAST44_RS10395 | Protein ID | WP_011447039.1 |
Coordinates | 2111449..2111625 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2111326..2111381 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAST44_RS10355 | 2106656..2106916 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAST44_RS10360 | 2106969..2107319 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
SAST44_RS10365 | 2108005..2108454 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAST44_RS10370 | 2108549..2108884 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
SAST44_RS10375 | 2109534..2110025 | - | 492 | WP_000919350.1 | staphylokinase | - |
SAST44_RS10380 | 2110216..2110971 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAST44_RS10385 | 2110983..2111237 | - | 255 | WP_000611512.1 | phage holin | - |
SAST44_RS10390 | 2111289..2111396 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2111318..2111457 | + | 140 | NuclAT_1 | - | - |
- | 2111318..2111457 | + | 140 | NuclAT_1 | - | - |
- | 2111318..2111457 | + | 140 | NuclAT_1 | - | - |
- | 2111318..2111457 | + | 140 | NuclAT_1 | - | - |
- | 2111326..2111381 | + | 56 | - | - | Antitoxin |
SAST44_RS10395 | 2111449..2111625 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAST44_RS10400 | 2111734..2112507 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
SAST44_RS10405 | 2112928..2113302 | - | 375 | WP_000340977.1 | hypothetical protein | - |
SAST44_RS10410 | 2113358..2113645 | - | 288 | WP_001040259.1 | hypothetical protein | - |
SAST44_RS10415 | 2113692..2113844 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / sea / hlb / tsst-1 / groEL | 2106969..2174933 | 67964 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T113196 WP_011447039.1 NZ_CP033112:c2111625-2111449 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T113196 NZ_CP033112:c2111625-2111449 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT113196 NZ_CP033112:2111326-2111381 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|