Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48578..48831 | Replicon | plasmid p2_W2-5 |
| Accession | NZ_CP032991 | ||
| Organism | Escherichia coli strain W2-5 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | D9V55_RS25050 | Protein ID | WP_001312851.1 |
| Coordinates | 48578..48727 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 48772..48831 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9V55_RS25585 | 43884..43988 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| D9V55_RS25010 | 44218..44406 | + | 189 | WP_000957857.1 | hypothetical protein | - |
| D9V55_RS25015 | 44416..45615 | + | 1200 | WP_000948429.1 | IS91 family transposase | - |
| D9V55_RS25590 | 45779..45937 | - | 159 | WP_047667301.1 | membrane protein | - |
| D9V55_RS25030 | 46877..47734 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| D9V55_RS25035 | 47727..47801 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| D9V55_RS25045 | 48046..48294 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| D9V55_RS25050 | 48578..48727 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 48772..48831 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 48772..48831 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 48772..48831 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 48772..48831 | + | 60 | NuclAT_1 | - | Antitoxin |
| D9V55_RS25060 | 49032..49262 | - | 231 | WP_001736714.1 | hypothetical protein | - |
| D9V55_RS25065 | 49426..50025 | - | 600 | WP_032083981.1 | hypothetical protein | - |
| D9V55_RS25070 | 50411..50611 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| D9V55_RS25075 | 50743..51303 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| D9V55_RS25080 | 51358..52104 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 | - | 1..83867 | 83867 | |
| - | flank | IS/Tn | - | - | 44416..45615 | 1199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T112919 WP_001312851.1 NZ_CP032991:c48727-48578 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T112919 NZ_CP032991:c48727-48578 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT112919 NZ_CP032991:48772-48831 [Escherichia coli]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|