Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 63174..63438 | Replicon | plasmid pCTXM14_020022 |
Accession | NZ_CP032888 | ||
Organism | Escherichia coli strain SCEC020022 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | C7V31_RS01260 | Protein ID | WP_001303307.1 |
Coordinates | 63286..63438 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 63174..63236 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7V31_RS01245 | 59276..60346 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
C7V31_RS01250 | 60365..61573 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 61753..61813 | - | 61 | NuclAT_1 | - | - |
- | 61753..61813 | - | 61 | NuclAT_1 | - | - |
- | 61753..61813 | - | 61 | NuclAT_1 | - | - |
- | 61753..61813 | - | 61 | NuclAT_1 | - | - |
C7V31_RS01255 | 61880..62971 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 63174..63236 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 63174..63236 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 63174..63236 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 63174..63236 | - | 63 | NuclAT_0 | - | Antitoxin |
C7V31_RS01260 | 63286..63438 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
C7V31_RS01265 | 63510..63761 | - | 252 | WP_001291968.1 | hypothetical protein | - |
- | 64148..64199 | - | 52 | NuclAT_2 | - | - |
- | 64148..64199 | - | 52 | NuclAT_2 | - | - |
- | 64148..64199 | - | 52 | NuclAT_2 | - | - |
- | 64148..64199 | - | 52 | NuclAT_2 | - | - |
C7V31_RS27195 | 64685..64861 | - | 177 | WP_001054900.1 | hypothetical protein | - |
C7V31_RS01280 | 65070..65279 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
C7V31_RS01285 | 65377..65991 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
C7V31_RS01290 | 66067..68235 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / blaCTX-M-14b | - | 1..109553 | 109553 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T112753 WP_001303307.1 NZ_CP032888:63286-63438 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T112753 NZ_CP032888:63286-63438 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT112753 NZ_CP032888:c63236-63174 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|