Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 5094003..5094224 | Replicon | chromosome |
| Accession | NZ_CP032879 | ||
| Organism | Escherichia coli strain WCHEC000837 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | D9N32_RS27385 | Protein ID | WP_000176713.1 |
| Coordinates | 5094003..5094110 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 5094158..5094224 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9N32_RS27350 | 5089137..5090219 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| D9N32_RS27355 | 5090219..5091052 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| D9N32_RS27360 | 5091049..5091441 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| D9N32_RS27365 | 5091445..5092254 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| D9N32_RS27370 | 5092290..5093144 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| D9N32_RS27380 | 5093339..5093797 | + | 459 | WP_000526135.1 | IS200/IS605 family transposase | - |
| D9N32_RS27385 | 5094003..5094110 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 5094158..5094224 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_42 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_42 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_42 | - | Antitoxin |
| - | 5094158..5094224 | + | 67 | NuclAT_42 | - | Antitoxin |
| - | 5094160..5094223 | + | 64 | NuclAT_45 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_45 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_45 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_45 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_47 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_47 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_47 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_47 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_49 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_49 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_49 | - | - |
| - | 5094160..5094223 | + | 64 | NuclAT_49 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5093339..5093797 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T112751 WP_000176713.1 NZ_CP032879:c5094110-5094003 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T112751 NZ_CP032879:c5094110-5094003 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT112751 NZ_CP032879:5094158-5094224 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|