Detailed information of TA system TA112751

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 5094003..5094224
• Replicon: chromosome
• Accession: NZ_CP032879
• Organism: Escherichia coli strain WCHEC000837

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A229AEQ8
• Locus tag: D9N32_RS27385
• Protein ID: WP_000176713.1
• Coordinates: 5094003..5094110 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	5094158..5094224 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
D9N32_RS27350	5089137..5090219	+	1083	WP_000804726.1	peptide chain release factor 1	-
D9N32_RS27355	5090219..5091052	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
D9N32_RS27360	5091049..5091441	+	393	WP_000200377.1	invasion regulator SirB2	-
D9N32_RS27365	5091445..5092254	+	810	WP_001257044.1	invasion regulator SirB1	-
D9N32_RS27370	5092290..5093144	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
D9N32_RS27380	5093339..5093797	+	459	WP_000526135.1	IS200/IS605 family transposase	-
D9N32_RS27385	5094003..5094110	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	5094158..5094224	+	67	NuclAT_20	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_20	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_20	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_20	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_25	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_25	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_25	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_25	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_30	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_30	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_30	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_30	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_35	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_35	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_35	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_35	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_37	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_37	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_37	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_37	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_42	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_42	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_42	-	Antitoxin
-	5094158..5094224	+	67	NuclAT_42	-	Antitoxin
-	5094160..5094223	+	64	NuclAT_45	-	-
-	5094160..5094223	+	64	NuclAT_45	-	-
-	5094160..5094223	+	64	NuclAT_45	-	-
-	5094160..5094223	+	64	NuclAT_45	-	-
-	5094160..5094223	+	64	NuclAT_47	-	-
-	5094160..5094223	+	64	NuclAT_47	-	-
-	5094160..5094223	+	64	NuclAT_47	-	-
-	5094160..5094223	+	64	NuclAT_47	-	-
-	5094160..5094223	+	64	NuclAT_49	-	-
-	5094160..5094223	+	64	NuclAT_49	-	-
-	5094160..5094223	+	64	NuclAT_49	-	-
-	5094160..5094223	+	64	NuclAT_49	-	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	5093339..5093797	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T112751 WP_000176713.1 NZ_CP032879:c5094110-5094003 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T112751 NZ_CP032879:c5094110-5094003 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT112751 NZ_CP032879:5094158-5094224 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A229AEQ8

Antitoxin