Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4527..4760 | Replicon | plasmid pCTXM15_000837 |
| Accession | NZ_CP032877 | ||
| Organism | Escherichia coli strain WCHEC000837 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | D9N32_RS00690 | Protein ID | WP_001312861.1 |
| Coordinates | 4602..4760 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 4527..4558 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9N32_RS00660 | 606..1145 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| D9N32_RS00665 | 1213..1446 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| D9N32_RS00670 | 1474..1671 | + | 198 | Protein_2 | hypothetical protein | - |
| D9N32_RS00675 | 1726..2160 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| D9N32_RS00680 | 2157..2876 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| D9N32_RS27405 | 2888..3076 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 2888..3085 | + | 198 | NuclAT_0 | - | - |
| - | 2888..3085 | + | 198 | NuclAT_0 | - | - |
| - | 2888..3085 | + | 198 | NuclAT_0 | - | - |
| - | 2888..3085 | + | 198 | NuclAT_0 | - | - |
| D9N32_RS00685 | 3133..4502 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 4527..4558 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 4527..4558 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 4527..4558 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 4527..4558 | + | 32 | NuclAT_1 | - | Antitoxin |
| D9N32_RS00690 | 4602..4760 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D9N32_RS00695 | 5155..6822 | - | 1668 | WP_012372796.1 | group II intron reverse transcriptase/maturase | - |
| D9N32_RS00705 | 8024..8311 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| D9N32_RS00710 | 8429..9250 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B) | - | 1..150853 | 150853 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T112712 WP_001312861.1 NZ_CP032877:4602-4760 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T112712 NZ_CP032877:4602-4760 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT112712 NZ_CP032877:4527-4558 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|