Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2191980..2192160 | Replicon | chromosome |
Accession | NZ_CP032821 | ||
Organism | Staphylococcus aureus strain JDFM SA01 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | D5S13_RS11015 | Protein ID | WP_001801861.1 |
Coordinates | 2192065..2192160 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2191980..2192037 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D5S13_RS10985 (D5S13_02098) | 2188331..2189449 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
D5S13_RS10990 (D5S13_02099) | 2190097..2190540 | + | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
D5S13_RS10995 (D5S13_02100) | 2190819..2191097 | + | 279 | WP_001798632.1 | DUF1433 domain-containing protein | - |
D5S13_RS11000 (D5S13_02101) | 2191119..2191493 | + | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
D5S13_RS11005 | 2191681..2191863 | + | 183 | Protein_2120 | transposase | - |
D5S13_RS11010 | 2191841..2191942 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 2191980..2192037 | + | 58 | - | - | Antitoxin |
D5S13_RS11015 | 2192065..2192160 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
D5S13_RS11020 (D5S13_02102) | 2192611..2193057 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
D5S13_RS11025 (D5S13_02103) | 2193742..2194125 | + | 384 | WP_000070811.1 | hypothetical protein | - |
D5S13_RS11030 (D5S13_02104) | 2194136..2194312 | + | 177 | WP_000375476.1 | hypothetical protein | - |
D5S13_RS11035 (D5S13_02105) | 2194612..2195240 | + | 629 | Protein_2126 | ImmA/IrrE family metallo-endopeptidase | - |
D5S13_RS11040 | 2195438..2196010 | - | 573 | Protein_2127 | hypothetical protein | - |
D5S13_RS11045 (D5S13_02108) | 2196111..2196452 | - | 342 | WP_000627548.1 | DUF3969 family protein | - |
D5S13_RS11050 (D5S13_02109) | 2196493..2197119 | - | 627 | WP_000669019.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 2142575..2198885 | 56310 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T112594 WP_001801861.1 NZ_CP032821:c2192160-2192065 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T112594 NZ_CP032821:c2192160-2192065 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT112594 NZ_CP032821:2191980-2192037 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|