Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1621328..1621512 | Replicon | chromosome |
Accession | NZ_CP032821 | ||
Organism | Staphylococcus aureus strain JDFM SA01 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | D5S13_RS07865 | Protein ID | WP_072467491.1 |
Coordinates | 1621328..1621435 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1621452..1621512 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D5S13_RS07840 (D5S13_01505) | 1616701..1617174 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
D5S13_RS07845 (D5S13_01506) | 1617297..1618508 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
D5S13_RS07850 (D5S13_01507) | 1618690..1619349 | - | 660 | WP_000831298.1 | membrane protein | - |
D5S13_RS07855 (D5S13_01508) | 1619409..1620551 | - | 1143 | WP_001176873.1 | glycerate kinase | - |
D5S13_RS07860 (D5S13_01509) | 1620808..1621194 | + | 387 | WP_000779348.1 | flippase GtxA | - |
D5S13_RS07865 | 1621328..1621435 | + | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1621452..1621512 | - | 61 | - | - | Antitoxin |
D5S13_RS07870 (D5S13_01510) | 1622025..1623788 | + | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein | - |
D5S13_RS07875 (D5S13_01511) | 1623813..1625546 | + | 1734 | WP_000486502.1 | ABC transporter ATP-binding protein | - |
D5S13_RS07880 | 1625777..1625944 | + | 168 | WP_031866196.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T112583 WP_072467491.1 NZ_CP032821:1621328-1621435 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
>T112583 NZ_CP032821:1621328-1621435 [Staphylococcus aureus]
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT112583 NZ_CP032821:c1621512-1621452 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|