Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22251..22520 | Replicon | plasmid pERL04-3476-2 |
| Accession | NZ_CP032810 | ||
| Organism | Escherichia coli strain ERL04-3476 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | D8Z68_RS29120 | Protein ID | WP_001312861.1 |
| Coordinates | 22362..22520 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 22251..22316 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8Z68_RS29075 | 17478..17702 | - | 225 | WP_001427866.1 | hypothetical protein | - |
| D8Z68_RS29095 | 18044..18571 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| D8Z68_RS29100 | 18627..18860 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| D8Z68_RS29105 | 18919..20877 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| D8Z68_RS29110 | 20932..21366 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| D8Z68_RS29115 | 21363..22082 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| D8Z68_RS29585 | 22094..22282 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 22094..22318 | + | 225 | NuclAT_0 | - | - |
| - | 22094..22318 | + | 225 | NuclAT_0 | - | - |
| - | 22094..22318 | + | 225 | NuclAT_0 | - | - |
| - | 22094..22318 | + | 225 | NuclAT_0 | - | - |
| - | 22251..22316 | + | 66 | - | - | Antitoxin |
| D8Z68_RS29120 | 22362..22520 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D8Z68_RS29590 | 22874..23098 | - | 225 | WP_001340580.1 | hypothetical protein | - |
| D8Z68_RS29145 | 23439..23726 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| D8Z68_RS29150 | 23847..24668 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| D8Z68_RS29155 | 24965..25612 | - | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| D8Z68_RS29160 | 25889..26272 | + | 384 | WP_000124983.1 | relaxosome protein TraM | - |
| D8Z68_RS29165 | 26463..27149 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| D8Z68_RS29170 | 27243..27470 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..61441 | 61441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T112541 WP_001312861.1 NZ_CP032810:22362-22520 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T112541 NZ_CP032810:22362-22520 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT112541 NZ_CP032810:22251-22316 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|