Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2901056..2901281 | Replicon | chromosome |
| Accession | NZ_CP032808 | ||
| Organism | Escherichia coli strain ERL04-3476 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | D8Z68_RS15310 | Protein ID | WP_000813258.1 |
| Coordinates | 2901126..2901281 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2901056..2901114 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8Z68_RS15260 | 2896121..2896363 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| D8Z68_RS15265 | 2896347..2896772 | + | 426 | WP_151547382.1 | Rha family transcriptional regulator | - |
| D8Z68_RS15270 | 2896841..2897884 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| D8Z68_RS15275 | 2897877..2898338 | + | 462 | WP_000139447.1 | replication protein | - |
| D8Z68_RS15280 | 2898372..2899088 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| D8Z68_RS15285 | 2899121..2899402 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| D8Z68_RS15290 | 2899399..2899626 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| D8Z68_RS15295 | 2899619..2899930 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| D8Z68_RS15300 | 2900058..2900276 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| D8Z68_RS15305 | 2900278..2900835 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2901056..2901114 | - | 59 | - | - | Antitoxin |
| D8Z68_RS15310 | 2901126..2901281 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D8Z68_RS15315 | 2901401..2901745 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| D8Z68_RS15320 | 2901867..2902139 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| D8Z68_RS15325 | 2902141..2903190 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| D8Z68_RS15330 | 2903203..2903508 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| D8Z68_RS15335 | 2903571..2904125 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| D8Z68_RS15340 | 2904350..2904547 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| D8Z68_RS15345 | 2904683..2905396 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| D8Z68_RS15360 | 2905847..2906278 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2895391..2941036 | 45645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T112522 WP_000813258.1 NZ_CP032808:2901126-2901281 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T112522 NZ_CP032808:2901126-2901281 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT112522 NZ_CP032808:c2901114-2901056 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|