Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2666779..2667004 | Replicon | chromosome |
Accession | NZ_CP032803 | ||
Organism | Escherichia coli strain ERL05-1306 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | D8Z70_RS13920 | Protein ID | WP_000935259.1 |
Coordinates | 2666792..2667004 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2666779..2666837 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z70_RS13870 | 2661844..2662086 | + | 243 | WP_000747948.1 | hypothetical protein | - |
D8Z70_RS13875 | 2662070..2662495 | + | 426 | WP_151547382.1 | Rha family transcriptional regulator | - |
D8Z70_RS13880 | 2662564..2663607 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
D8Z70_RS13885 | 2663600..2664061 | + | 462 | WP_000139447.1 | replication protein | - |
D8Z70_RS13890 | 2664095..2664811 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
D8Z70_RS13895 | 2664844..2665125 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
D8Z70_RS13900 | 2665122..2665349 | + | 228 | WP_000699809.1 | hypothetical protein | - |
D8Z70_RS13905 | 2665342..2665653 | + | 312 | WP_001289673.1 | hypothetical protein | - |
D8Z70_RS13910 | 2665781..2665999 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
D8Z70_RS13915 | 2666001..2666558 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2666779..2666837 | - | 59 | - | - | Antitoxin |
D8Z70_RS13920 | 2666792..2667004 | + | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
D8Z70_RS13925 | 2667124..2667468 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
D8Z70_RS13930 | 2667590..2667862 | + | 273 | WP_151547383.1 | hypothetical protein | - |
D8Z70_RS13935 | 2667864..2668913 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
D8Z70_RS13940 | 2668926..2669231 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
D8Z70_RS13945 | 2669294..2669848 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
D8Z70_RS13950 | 2670073..2670270 | + | 198 | WP_000917763.1 | hypothetical protein | - |
D8Z70_RS13955 | 2670406..2671119 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
D8Z70_RS13970 | 2671570..2672001 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2599890..2736790 | 136900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T112451 WP_000935259.1 NZ_CP032803:2666792-2667004 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T112451 NZ_CP032803:2666792-2667004 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT112451 NZ_CP032803:c2666837-2666779 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|