Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 24642..24911 | Replicon | plasmid pERL06-2497-2 |
| Accession | NZ_CP032799 | ||
| Organism | Escherichia coli strain ERL06-2497 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | D8Z72_RS28835 | Protein ID | WP_001312861.1 |
| Coordinates | 24753..24911 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 24642..24707 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8Z72_RS28790 | 19705..19938 | + | 234 | WP_071588969.1 | hypothetical protein | - |
| D8Z72_RS28810 | 20411..20950 | + | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
| D8Z72_RS28815 | 21012..21245 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| D8Z72_RS28820 | 21310..23268 | + | 1959 | WP_001530506.1 | ParB/RepB/Spo0J family partition protein | - |
| D8Z72_RS28825 | 23323..23757 | + | 435 | WP_000845923.1 | conjugation system SOS inhibitor PsiB | - |
| D8Z72_RS28830 | 23754..24473 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| D8Z72_RS29290 | 24485..24673 | - | 189 | WP_001336239.1 | hypothetical protein | - |
| - | 24485..24709 | + | 225 | NuclAT_0 | - | - |
| - | 24485..24709 | + | 225 | NuclAT_0 | - | - |
| - | 24485..24709 | + | 225 | NuclAT_0 | - | - |
| - | 24485..24709 | + | 225 | NuclAT_0 | - | - |
| - | 24642..24707 | + | 66 | - | - | Antitoxin |
| D8Z72_RS28835 | 24753..24911 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D8Z72_RS28850 | 25832..26119 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| D8Z72_RS28855 | 26238..27059 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| D8Z72_RS28860 | 27356..27946 | - | 591 | WP_165850686.1 | transglycosylase SLT domain-containing protein | - |
| D8Z72_RS28865 | 28279..28662 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| D8Z72_RS28870 | 28849..29538 | + | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..63089 | 63089 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T112394 WP_001312861.1 NZ_CP032799:24753-24911 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T112394 NZ_CP032799:24753-24911 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT112394 NZ_CP032799:24642-24707 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|