Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3355325..3355550 | Replicon | chromosome |
Accession | NZ_CP032793 | ||
Organism | Escherichia coli strain NZRM3614 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | D8Z74_RS17390 | Protein ID | WP_000813263.1 |
Coordinates | 3355325..3355480 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3355492..3355550 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z74_RS17355 | 3350779..3351492 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
D8Z74_RS17360 | 3351630..3351826 | - | 197 | Protein_3317 | TrmB family transcriptional regulator | - |
D8Z74_RS17365 | 3352113..3352931 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
D8Z74_RS17370 | 3353083..3353454 | - | 372 | WP_000090264.1 | antitermination protein | - |
D8Z74_RS17375 | 3353444..3353815 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
D8Z74_RS17380 | 3353828..3354877 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
D8Z74_RS17385 | 3354879..3355157 | - | 279 | WP_001341388.1 | hypothetical protein | - |
D8Z74_RS17390 | 3355325..3355480 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3355492..3355550 | + | 59 | - | - | Antitoxin |
D8Z74_RS17405 | 3356085..3356858 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
D8Z74_RS17410 | 3357210..3357623 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
D8Z74_RS17415 | 3357639..3358409 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
D8Z74_RS17420 | 3358431..3359177 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
D8Z74_RS17425 | 3359184..3360275 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T112311 WP_000813263.1 NZ_CP032793:c3355480-3355325 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T112311 NZ_CP032793:c3355480-3355325 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT112311 NZ_CP032793:3355492-3355550 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|