Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2525371..2525596 | Replicon | chromosome |
Accession | NZ_CP032793 | ||
Organism | Escherichia coli strain NZRM3614 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | D8Z74_RS12880 | Protein ID | WP_000813258.1 |
Coordinates | 2525441..2525596 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2525371..2525429 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z74_RS12830 | 2520477..2520719 | + | 243 | WP_000747948.1 | hypothetical protein | - |
D8Z74_RS12835 | 2520703..2521128 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
D8Z74_RS12840 | 2521197..2522240 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
D8Z74_RS12845 | 2522233..2522694 | + | 462 | WP_000139447.1 | replication protein | - |
D8Z74_RS12850 | 2522728..2523403 | + | 676 | Protein_2467 | DUF1627 domain-containing protein | - |
D8Z74_RS12855 | 2523436..2523717 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
D8Z74_RS12860 | 2523714..2523941 | + | 228 | WP_000699809.1 | hypothetical protein | - |
D8Z74_RS12865 | 2523934..2524245 | + | 312 | WP_001289673.1 | hypothetical protein | - |
D8Z74_RS12870 | 2524373..2524591 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
D8Z74_RS12875 | 2524593..2525150 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2525371..2525429 | - | 59 | - | - | Antitoxin |
D8Z74_RS12880 | 2525441..2525596 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
D8Z74_RS12885 | 2525716..2526060 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
D8Z74_RS12890 | 2526182..2526454 | + | 273 | WP_000191872.1 | hypothetical protein | - |
D8Z74_RS12895 | 2526456..2527505 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
D8Z74_RS12900 | 2527518..2527823 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
D8Z74_RS12905 | 2527886..2528440 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
D8Z74_RS12910 | 2528665..2528862 | + | 198 | WP_000917763.1 | hypothetical protein | - |
D8Z74_RS12915 | 2528998..2529711 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
D8Z74_RS12930 | 2530162..2530593 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2457353..2569610 | 112257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T112307 WP_000813258.1 NZ_CP032793:2525441-2525596 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T112307 NZ_CP032793:2525441-2525596 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT112307 NZ_CP032793:c2525429-2525371 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|