Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2477448..2477673 | Replicon | chromosome |
| Accession | NZ_CP032793 | ||
| Organism | Escherichia coli strain NZRM3614 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | D8Z74_RS12565 | Protein ID | WP_000813254.1 |
| Coordinates | 2477518..2477673 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2477448..2477506 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8Z74_RS12520 | 2472701..2473654 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
| D8Z74_RS12525 | 2473661..2474401 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
| D8Z74_RS12530 | 2474431..2475201 | + | 771 | WP_025840156.1 | DUF1627 domain-containing protein | - |
| D8Z74_RS12535 | 2475217..2475612 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
| D8Z74_RS12540 | 2475669..2476025 | + | 357 | WP_001302146.1 | hypothetical protein | - |
| D8Z74_RS12545 | 2476074..2476286 | + | 213 | WP_000063625.1 | hypothetical protein | - |
| D8Z74_RS12550 | 2476322..2476693 | + | 372 | WP_000137941.1 | hypothetical protein | - |
| D8Z74_RS12555 | 2476690..2477052 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
| D8Z74_RS12560 | 2477168..2477272 | + | 105 | WP_001278450.1 | hypothetical protein | - |
| - | 2477448..2477506 | - | 59 | - | - | Antitoxin |
| D8Z74_RS12565 | 2477518..2477673 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| D8Z74_RS27850 | 2477952..2478119 | + | 168 | WP_000998188.1 | hypothetical protein | - |
| D8Z74_RS12570 | 2478185..2478463 | + | 279 | WP_001304183.1 | hypothetical protein | - |
| D8Z74_RS12575 | 2478465..2479514 | + | 1050 | WP_001302870.1 | DUF968 domain-containing protein | - |
| D8Z74_RS12580 | 2479527..2479901 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
| D8Z74_RS12585 | 2479898..2480719 | + | 822 | WP_000762904.1 | antitermination protein | - |
| D8Z74_RS12590 | 2480946..2481143 | + | 198 | WP_000917735.1 | hypothetical protein | - |
| D8Z74_RS12595 | 2481294..2482352 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 2457353..2569610 | 112257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T112305 WP_000813254.1 NZ_CP032793:2477518-2477673 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T112305 NZ_CP032793:2477518-2477673 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT112305 NZ_CP032793:c2477506-2477448 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|