Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 277125..277346 | Replicon | chromosome |
| Accession | NZ_CP032793 | ||
| Organism | Escherichia coli strain NZRM3614 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | D8Z74_RS01370 | Protein ID | WP_001295224.1 |
| Coordinates | 277239..277346 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 277125..277190 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8Z74_RS01345 | 272565..273467 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| D8Z74_RS01350 | 273478..274461 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| D8Z74_RS01355 | 274458..275462 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| D8Z74_RS01360 | 275492..276763 | - | 1272 | WP_001301684.1 | amino acid permease | - |
| - | 277125..277190 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 277125..277190 | - | 66 | NuclAT_21 | - | Antitoxin |
| D8Z74_RS01370 | 277239..277346 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| D8Z74_RS01375 | 277433..279112 | - | 1680 | WP_001691049.1 | cellulose biosynthesis protein BcsG | - |
| D8Z74_RS01380 | 279109..279300 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| D8Z74_RS01385 | 279297..280868 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| D8Z74_RS01390 | 281141..281329 | + | 189 | WP_001063316.1 | YhjR family protein | - |
| D8Z74_RS01395 | 281341..281538 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
| D8Z74_RS01400 | 281557..282093 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T112288 WP_001295224.1 NZ_CP032793:277239-277346 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T112288 NZ_CP032793:277239-277346 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT112288 NZ_CP032793:c277190-277125 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|