Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3481440..3481665 | Replicon | chromosome |
Accession | NZ_CP032791 | ||
Organism | Escherichia coli strain NZRM4165 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | D8Z75_RS18275 | Protein ID | WP_000813263.1 |
Coordinates | 3481440..3481595 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3481607..3481665 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z75_RS18240 | 3476894..3477607 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
D8Z75_RS18245 | 3477745..3477941 | - | 197 | Protein_3449 | TrmB family transcriptional regulator | - |
D8Z75_RS18250 | 3478228..3479046 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
D8Z75_RS18255 | 3479198..3479569 | - | 372 | WP_000090264.1 | antitermination protein | - |
D8Z75_RS18260 | 3479559..3479930 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
D8Z75_RS18265 | 3479943..3480992 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
D8Z75_RS18270 | 3480994..3481272 | - | 279 | WP_001341388.1 | hypothetical protein | - |
D8Z75_RS18275 | 3481440..3481595 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3481607..3481665 | + | 59 | - | - | Antitoxin |
D8Z75_RS18290 | 3482200..3482973 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
D8Z75_RS18295 | 3483325..3483738 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
D8Z75_RS18300 | 3483754..3484524 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
D8Z75_RS18305 | 3484546..3485292 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
D8Z75_RS18310 | 3485299..3486390 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T112274 WP_000813263.1 NZ_CP032791:c3481595-3481440 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T112274 NZ_CP032791:c3481595-3481440 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT112274 NZ_CP032791:3481607-3481665 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|