Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2664647..2664872 | Replicon | chromosome |
Accession | NZ_CP032791 | ||
Organism | Escherichia coli strain NZRM4165 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | D8Z75_RS13480 | Protein ID | WP_000935259.1 |
Coordinates | 2664647..2664859 (-) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2664814..2664872 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z75_RS13430 | 2659650..2660081 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
D8Z75_RS13445 | 2660532..2661245 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
D8Z75_RS13450 | 2661381..2661578 | - | 198 | WP_000917763.1 | hypothetical protein | - |
D8Z75_RS13455 | 2661803..2662357 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
D8Z75_RS13460 | 2662420..2662725 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
D8Z75_RS13465 | 2662738..2663787 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
D8Z75_RS13470 | 2663789..2664061 | - | 273 | WP_000191872.1 | hypothetical protein | - |
D8Z75_RS13475 | 2664183..2664527 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
D8Z75_RS13480 | 2664647..2664859 | - | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2664814..2664872 | + | 59 | - | - | Antitoxin |
D8Z75_RS13485 | 2665093..2665650 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
D8Z75_RS13490 | 2665652..2665870 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
D8Z75_RS13495 | 2665998..2666309 | - | 312 | WP_001289673.1 | hypothetical protein | - |
D8Z75_RS13500 | 2666302..2666529 | - | 228 | WP_000699809.1 | hypothetical protein | - |
D8Z75_RS13505 | 2666526..2666807 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
D8Z75_RS13510 | 2666840..2667556 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
D8Z75_RS13515 | 2667590..2668051 | - | 462 | WP_000139447.1 | replication protein | - |
D8Z75_RS13520 | 2668044..2669087 | - | 1044 | WP_001262402.1 | hypothetical protein | - |
D8Z75_RS13525 | 2669156..2669581 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
D8Z75_RS13530 | 2669565..2669807 | - | 243 | WP_000747948.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | espJ / espFu/tccP / nleG7' / paa | 2625365..2725529 | 100164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T112271 WP_000935259.1 NZ_CP032791:c2664859-2664647 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T112271 NZ_CP032791:c2664859-2664647 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT112271 NZ_CP032791:2664814-2664872 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|