Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 277126..277347 | Replicon | chromosome |
Accession | NZ_CP032789 | ||
Organism | Escherichia coli strain NZRM4169 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | D8Z76_RS01370 | Protein ID | WP_001295224.1 |
Coordinates | 277240..277347 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 277126..277191 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z76_RS01345 | 272566..273468 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
D8Z76_RS01350 | 273479..274462 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
D8Z76_RS01355 | 274459..275463 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
D8Z76_RS01360 | 275493..276764 | - | 1272 | WP_001301684.1 | amino acid permease | - |
- | 277126..277191 | - | 66 | NuclAT_17 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_17 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_17 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_17 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_22 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_22 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_22 | - | Antitoxin |
- | 277126..277191 | - | 66 | NuclAT_22 | - | Antitoxin |
D8Z76_RS01370 | 277240..277347 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
D8Z76_RS01375 | 277434..279113 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
D8Z76_RS01380 | 279110..279301 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
D8Z76_RS01385 | 279298..280869 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
D8Z76_RS01390 | 281142..281330 | + | 189 | WP_001063316.1 | YhjR family protein | - |
D8Z76_RS01395 | 281342..281539 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
D8Z76_RS01400 | 281558..282094 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T112209 WP_001295224.1 NZ_CP032789:277240-277347 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T112209 NZ_CP032789:277240-277347 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT112209 NZ_CP032789:c277191-277126 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|