Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1735907..1736132 | Replicon | chromosome |
Accession | NZ_CP032513 | ||
Organism | Shigella flexneri strain SFL1520 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | D6T62_RS09415 | Protein ID | WP_000813254.1 |
Coordinates | 1735907..1736062 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1736074..1736132 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D6T62_RS09380 | 1731167..1731532 | + | 366 | WP_000124125.1 | hypothetical protein | - |
D6T62_RS09385 | 1731532..1732719 | + | 1188 | Protein_1785 | IS91 family transposase | - |
D6T62_RS09390 | 1733130..1733684 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
D6T62_RS09395 | 1733681..1733971 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
D6T62_RS09400 | 1733971..1734570 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
D6T62_RS09405 | 1734704..1735401 | + | 698 | WP_237160603.1 | IS1 family transposase | - |
D6T62_RS09415 | 1735907..1736062 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 1736074..1736132 | + | 59 | - | - | Antitoxin |
D6T62_RS09420 | 1736517..1736882 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
D6T62_RS24445 | 1736882..1737547 | - | 666 | WP_005115317.1 | hypothetical protein | - |
D6T62_RS09430 | 1737547..1737909 | - | 363 | Protein_1793 | HNH endonuclease | - |
D6T62_RS09435 | 1737911..1738129 | - | 219 | WP_000256997.1 | DUF4014 family protein | - |
D6T62_RS09440 | 1738222..1738578 | - | 357 | WP_000403784.1 | hypothetical protein | - |
D6T62_RS09445 | 1738636..1739058 | - | 423 | WP_001118171.1 | DUF977 family protein | - |
D6T62_RS09450 | 1739073..1739819 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
D6T62_RS24450 | 1739965..1740134 | - | 170 | Protein_1798 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | - | 1700669..1758991 | 58322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T111879 WP_000813254.1 NZ_CP032513:c1736062-1735907 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T111879 NZ_CP032513:c1736062-1735907 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT111879 NZ_CP032513:1736074-1736132 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|