Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 952559..952784 | Replicon | chromosome |
Accession | NZ_CP032513 | ||
Organism | Shigella flexneri strain SFL1520 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | D6T62_RS04945 | Protein ID | WP_000813254.1 |
Coordinates | 952559..952714 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 952726..952784 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D6T62_RS04880 | 947846..948193 | - | 348 | WP_000631709.1 | IS66 family insertion sequence element accessory protein TnpB | - |
D6T62_RS04885 | 948190..948864 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
D6T62_RS04890 | 948963..949178 | - | 216 | WP_000839572.1 | class II holin family protein | - |
D6T62_RS04920 | 949974..950690 | - | 717 | Protein_948 | bacteriophage antitermination protein Q | - |
D6T62_RS04925 | 950687..951052 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
D6T62_RS04930 | 951053..952111 | - | 1059 | Protein_950 | DUF968 domain-containing protein | - |
D6T62_RS04935 | 952113..952391 | - | 279 | WP_024260631.1 | hypothetical protein | - |
D6T62_RS04945 | 952559..952714 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 952726..952784 | + | 59 | - | - | Antitoxin |
D6T62_RS04960 | 953366..953782 | - | 417 | WP_005069274.1 | hypothetical protein | - |
D6T62_RS04965 | 953853..954554 | + | 702 | Protein_954 | IS1 family transposase | - |
D6T62_RS04970 | 954584..954898 | + | 315 | WP_001317924.1 | 3'-5' exonuclease | - |
D6T62_RS04975 | 954957..955160 | + | 204 | WP_000096344.1 | DUF4224 domain-containing protein | - |
D6T62_RS04980 | 955160..956210 | + | 1051 | Protein_957 | tyrosine-type recombinase/integrase | - |
D6T62_RS04990 | 956421..957218 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T111868 WP_000813254.1 NZ_CP032513:c952714-952559 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T111868 NZ_CP032513:c952714-952559 [Shigella flexneri]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT111868 NZ_CP032513:952726-952784 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|