Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1669..1939 | Replicon | plasmid unnamed1 |
Accession | NZ_CP032263 | ||
Organism | Escherichia coli strain AR_0089 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AM468_RS00020 | Protein ID | WP_001312861.1 |
Coordinates | 1781..1939 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 1669..1732 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AM468_RS00010 | 351..785 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
AM468_RS00015 | 782..1501 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
AM468_RS27070 | 1513..1701 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 1513..1737 | + | 225 | NuclAT_0 | - | - |
- | 1513..1737 | + | 225 | NuclAT_0 | - | - |
- | 1513..1737 | + | 225 | NuclAT_0 | - | - |
- | 1513..1737 | + | 225 | NuclAT_0 | - | - |
- | 1669..1732 | - | 64 | - | - | Antitoxin |
AM468_RS00020 | 1781..1939 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
AM468_RS27330 | 2630..2836 | + | 207 | WP_000547939.1 | hypothetical protein | - |
AM468_RS00040 | 2861..3148 | + | 288 | WP_000107535.1 | hypothetical protein | - |
AM468_RS00045 | 3269..4090 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AM468_RS00050 | 4387..4989 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
AM468_RS00055 | 5310..5693 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
AM468_RS00060 | 5880..6569 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | vat / iroN / iroE / iroD / iroC / iroB | 1..155784 | 155784 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T111537 WP_001312861.1 NZ_CP032263:1781-1939 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T111537 NZ_CP032263:1781-1939 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT111537 NZ_CP032263:c1732-1669 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|