Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-orzP/Ldr(toxin) |
| Location | 3591257..3591478 | Replicon | chromosome |
| Accession | NZ_CP032204 | ||
| Organism | Escherichia coli strain AR_0013 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | AM340_RS18095 | Protein ID | WP_000176713.1 |
| Coordinates | 3591257..3591364 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | orzP | ||
| Locus tag | - | ||
| Coordinates | 3591412..3591478 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM340_RS18070 | 3587101..3588183 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| AM340_RS18075 | 3588183..3589016 | + | 834 | WP_000456446.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| AM340_RS18080 | 3589013..3589405 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| AM340_RS18085 | 3589409..3590218 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| AM340_RS18090 | 3590254..3591108 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AM340_RS18095 | 3591257..3591364 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3591412..3591478 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 3591412..3591478 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 3591414..3591477 | + | 64 | NuclAT_46 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_46 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_46 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_46 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_48 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_48 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_48 | - | - |
| - | 3591414..3591477 | + | 64 | NuclAT_48 | - | - |
| AM340_RS18100 | 3591792..3591899 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3591952..3592013 | + | 62 | NuclAT_45 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_45 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_45 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_45 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_47 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_47 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_47 | - | - |
| - | 3591952..3592013 | + | 62 | NuclAT_47 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_14 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_14 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_14 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_14 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_16 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_16 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_16 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_16 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_18 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_18 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_18 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_18 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_20 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_20 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_20 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_20 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_22 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_22 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_22 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_22 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_24 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_24 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_24 | - | - |
| - | 3591952..3592014 | + | 63 | NuclAT_24 | - | - |
| AM340_RS18105 | 3592305..3593405 | - | 1101 | WP_001317783.1 | sodium-potassium/proton antiporter ChaA | - |
| AM340_RS18110 | 3593675..3593905 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| AM340_RS18115 | 3594063..3594758 | + | 696 | WP_015674647.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AM340_RS18120 | 3594802..3595155 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T111360 WP_000176713.1 NZ_CP032204:c3591364-3591257 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T111360 NZ_CP032204:c3591364-3591257 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT111360 NZ_CP032204:3591412-3591478 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|