Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 3591257..3591478 Replicon chromosome
Accession NZ_CP032204
Organism Escherichia coli strain AR_0013

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag AM340_RS18095 Protein ID WP_000176713.1
Coordinates 3591257..3591364 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 3591412..3591478 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM340_RS18070 3587101..3588183 + 1083 WP_000804726.1 peptide chain release factor 1 -
AM340_RS18075 3588183..3589016 + 834 WP_000456446.1 peptide chain release factor N(5)-glutamine methyltransferase -
AM340_RS18080 3589013..3589405 + 393 WP_000200374.1 invasion regulator SirB2 -
AM340_RS18085 3589409..3590218 + 810 WP_001257044.1 invasion regulator SirB1 -
AM340_RS18090 3590254..3591108 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AM340_RS18095 3591257..3591364 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3591412..3591478 + 67 NuclAT_13 - Antitoxin
- 3591412..3591478 + 67 NuclAT_13 - Antitoxin
- 3591412..3591478 + 67 NuclAT_13 - Antitoxin
- 3591412..3591478 + 67 NuclAT_13 - Antitoxin
- 3591412..3591478 + 67 NuclAT_15 - Antitoxin
- 3591412..3591478 + 67 NuclAT_15 - Antitoxin
- 3591412..3591478 + 67 NuclAT_15 - Antitoxin
- 3591412..3591478 + 67 NuclAT_15 - Antitoxin
- 3591412..3591478 + 67 NuclAT_17 - Antitoxin
- 3591412..3591478 + 67 NuclAT_17 - Antitoxin
- 3591412..3591478 + 67 NuclAT_17 - Antitoxin
- 3591412..3591478 + 67 NuclAT_17 - Antitoxin
- 3591412..3591478 + 67 NuclAT_19 - Antitoxin
- 3591412..3591478 + 67 NuclAT_19 - Antitoxin
- 3591412..3591478 + 67 NuclAT_19 - Antitoxin
- 3591412..3591478 + 67 NuclAT_19 - Antitoxin
- 3591412..3591478 + 67 NuclAT_21 - Antitoxin
- 3591412..3591478 + 67 NuclAT_21 - Antitoxin
- 3591412..3591478 + 67 NuclAT_21 - Antitoxin
- 3591412..3591478 + 67 NuclAT_21 - Antitoxin
- 3591412..3591478 + 67 NuclAT_23 - Antitoxin
- 3591412..3591478 + 67 NuclAT_23 - Antitoxin
- 3591412..3591478 + 67 NuclAT_23 - Antitoxin
- 3591412..3591478 + 67 NuclAT_23 - Antitoxin
- 3591414..3591477 + 64 NuclAT_46 - -
- 3591414..3591477 + 64 NuclAT_46 - -
- 3591414..3591477 + 64 NuclAT_46 - -
- 3591414..3591477 + 64 NuclAT_46 - -
- 3591414..3591477 + 64 NuclAT_48 - -
- 3591414..3591477 + 64 NuclAT_48 - -
- 3591414..3591477 + 64 NuclAT_48 - -
- 3591414..3591477 + 64 NuclAT_48 - -
AM340_RS18100 3591792..3591899 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3591952..3592013 + 62 NuclAT_45 - -
- 3591952..3592013 + 62 NuclAT_45 - -
- 3591952..3592013 + 62 NuclAT_45 - -
- 3591952..3592013 + 62 NuclAT_45 - -
- 3591952..3592013 + 62 NuclAT_47 - -
- 3591952..3592013 + 62 NuclAT_47 - -
- 3591952..3592013 + 62 NuclAT_47 - -
- 3591952..3592013 + 62 NuclAT_47 - -
- 3591952..3592014 + 63 NuclAT_14 - -
- 3591952..3592014 + 63 NuclAT_14 - -
- 3591952..3592014 + 63 NuclAT_14 - -
- 3591952..3592014 + 63 NuclAT_14 - -
- 3591952..3592014 + 63 NuclAT_16 - -
- 3591952..3592014 + 63 NuclAT_16 - -
- 3591952..3592014 + 63 NuclAT_16 - -
- 3591952..3592014 + 63 NuclAT_16 - -
- 3591952..3592014 + 63 NuclAT_18 - -
- 3591952..3592014 + 63 NuclAT_18 - -
- 3591952..3592014 + 63 NuclAT_18 - -
- 3591952..3592014 + 63 NuclAT_18 - -
- 3591952..3592014 + 63 NuclAT_20 - -
- 3591952..3592014 + 63 NuclAT_20 - -
- 3591952..3592014 + 63 NuclAT_20 - -
- 3591952..3592014 + 63 NuclAT_20 - -
- 3591952..3592014 + 63 NuclAT_22 - -
- 3591952..3592014 + 63 NuclAT_22 - -
- 3591952..3592014 + 63 NuclAT_22 - -
- 3591952..3592014 + 63 NuclAT_22 - -
- 3591952..3592014 + 63 NuclAT_24 - -
- 3591952..3592014 + 63 NuclAT_24 - -
- 3591952..3592014 + 63 NuclAT_24 - -
- 3591952..3592014 + 63 NuclAT_24 - -
AM340_RS18105 3592305..3593405 - 1101 WP_001317783.1 sodium-potassium/proton antiporter ChaA -
AM340_RS18110 3593675..3593905 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AM340_RS18115 3594063..3594758 + 696 WP_015674647.1 glutathione-specific gamma-glutamylcyclotransferase -
AM340_RS18120 3594802..3595155 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T111360 WP_000176713.1 NZ_CP032204:c3591364-3591257 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T111360 NZ_CP032204:c3591364-3591257 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT111360 NZ_CP032204:3591412-3591478 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References