Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 18509..18762 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP032202 | ||
| Organism | Escherichia coli strain AR_0086 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | AM465_RS26550 | Protein ID | WP_001336447.1 |
| Coordinates | 18613..18762 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 18509..18565 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM465_RS26515 | 14718..15167 | + | 450 | Protein_12 | type-F conjugative transfer system pilin acetylase TraX | - |
| AM465_RS26520 | 15222..15779 | + | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| AM465_RS26525 | 15931..16134 | + | 204 | WP_001336517.1 | hypothetical protein | - |
| AM465_RS26530 | 16876..17337 | + | 462 | WP_019842128.1 | thermonuclease family protein | - |
| AM465_RS28140 | 17440..17824 | + | 385 | Protein_16 | hypothetical protein | - |
| AM465_RS26540 | 17977..18414 | + | 438 | WP_000872609.1 | hypothetical protein | - |
| - | 18509..18565 | - | 57 | NuclAT_2 | - | Antitoxin |
| - | 18509..18565 | - | 57 | NuclAT_2 | - | Antitoxin |
| - | 18509..18565 | - | 57 | NuclAT_2 | - | Antitoxin |
| - | 18509..18565 | - | 57 | NuclAT_2 | - | Antitoxin |
| AM465_RS26550 | 18613..18762 | + | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AM465_RS26555 | 19047..19304 | + | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| AM465_RS26565 | 19540..19614 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| AM465_RS26570 | 19607..20464 | + | 858 | WP_000130646.1 | incFII family plasmid replication initiator RepA | - |
| AM465_RS26580 | 21403..22056 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| AM465_RS28020 | 22149..22406 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| AM465_RS26585 | 22339..22740 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..140509 | 140509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T111340 WP_001336447.1 NZ_CP032202:18613-18762 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T111340 NZ_CP032202:18613-18762 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT111340 NZ_CP032202:c18565-18509 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|