Detailed information of TA system TA111206

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 36082..36335
• Replicon: plasmid unnamed3
• Accession: NZ_CP032166
• Organism: Klebsiella pneumoniae strain XJ-K1

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: D3H40_RS29615
• Protein ID: WP_001312851.1
• Coordinates: 36082..36231 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	36276..36335 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
D3H40_RS29570	31441..31856	-	416	Protein_44	IS1 family transposase	-
D3H40_RS29575	32105..32506	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
D3H40_RS29580	32439..32696	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
D3H40_RS29585	32789..33442	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
D3H40_RS29595	34381..35238	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
D3H40_RS29600	35231..35305	-	75	WP_001375168.1	RepA leader peptide Tap	-
D3H40_RS29610	35550..35798	-	249	WP_000083837.1	replication regulatory protein RepA	-
D3H40_RS29615	36082..36231	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	36276..36335	+	60	NuclAT_0	-	Antitoxin
-	36276..36335	+	60	NuclAT_0	-	Antitoxin
-	36276..36335	+	60	NuclAT_0	-	Antitoxin
-	36276..36335	+	60	NuclAT_0	-	Antitoxin
D3H40_RS29625	36536..36766	-	231	WP_001736714.1	hypothetical protein	-
D3H40_RS29630	36930..37529	-	600	WP_032083981.1	hypothetical protein	-
D3H40_RS29635	37915..38115	-	201	WP_015059022.1	hypothetical protein	-
D3H40_RS29640	38247..38807	-	561	WP_000139328.1	fertility inhibition protein FinO	-
D3H40_RS29645	38862..39608	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
D3H40_RS29650	39628..39789	-	162	Protein_57	DNA helicase	-
D3H40_RS29655	39853..40557	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
D3H40_RS29665	40609..40953	+	345	Protein_59	IS6-like element IS26 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / blaSHV-12 / blaKPC-2	-	1..99048	99048

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T111206 WP_001312851.1 NZ_CP032166:c36231-36082 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T111206 NZ_CP032166:c36231-36082 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT111206 NZ_CP032166:36276-36335 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin