Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 46719..47145 | Replicon | plasmid p.CT30-P2 |
| Accession | NZ_CP032080 | ||
| Organism | Escherichia coli strain CT30 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | D2195_RS25110 | Protein ID | WP_001372321.1 |
| Coordinates | 46719..46844 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 46921..47145 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2195_RS25080 (42088) | 42088..42777 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| D2195_RS25085 (42964) | 42964..43347 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| D2195_RS25090 (43668) | 43668..44270 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| D2195_RS25095 (44567) | 44567..45388 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| D2195_RS25100 (45510) | 45510..45797 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| D2195_RS25105 (45822) | 45822..46028 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| D2195_RS26410 (46098) | 46098..46271 | + | 174 | Protein_51 | hypothetical protein | - |
| D2195_RS26415 (46269) | 46269..46499 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| D2195_RS25110 (46719) | 46719..46844 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D2195_RS26420 (46786) | 46786..46935 | - | 150 | Protein_54 | plasmid maintenance protein Mok | - |
| - (46921) | 46921..47145 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (46921) | 46921..47145 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (46921) | 46921..47145 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (46921) | 46921..47145 | - | 225 | NuclAT_0 | - | Antitoxin |
| D2195_RS25115 (46957) | 46957..47145 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| D2195_RS25120 (47114) | 47114..47876 | - | 763 | Protein_56 | plasmid SOS inhibition protein A | - |
| D2195_RS25125 (47873) | 47873..48307 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| D2195_RS25130 (48362) | 48362..50320 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| D2195_RS25135 (50379) | 50379..50612 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| D2195_RS25140 (50668) | 50668..51195 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| D2195_RS25145 (51668) | 51668..51928 | - | 261 | WP_072132736.1 | hypothetical protein | - |
| D2195_RS26425 (51838) | 51838..52083 | - | 246 | WP_241226192.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iutA / iucD / iucC / iucB / iucA / iroN / iroE / iroD / iroC / iroB | 1..146245 | 146245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T111046 WP_001372321.1 NZ_CP032080:c46844-46719 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T111046 NZ_CP032080:c46844-46719 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT111046 NZ_CP032080:c47145-46921 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|