Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 272167..272389 | Replicon | chromosome |
| Accession | NZ_CP032078 | ||
| Organism | Escherichia coli strain CT30 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | D2195_RS01295 | Protein ID | WP_000170738.1 |
| Coordinates | 272282..272389 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 272167..272233 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2195_RS01275 | 267608..268510 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| D2195_RS01280 | 268521..269504 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| D2195_RS01285 | 269501..270505 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| D2195_RS01290 | 270535..271806 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| - | 272167..272233 | - | 67 | - | - | Antitoxin |
| D2195_RS01295 | 272282..272389 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| D2195_RS01300 | 272765..272872 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| D2195_RS01305 | 273248..273355 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| D2195_RS01310 | 273731..273838 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| D2195_RS01315 | 273925..275604 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| D2195_RS01320 | 275601..275792 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| D2195_RS01325 | 275789..277360 | - | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T111016 WP_000170738.1 NZ_CP032078:272282-272389 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T111016 NZ_CP032078:272282-272389 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT111016 NZ_CP032078:c272233-272167 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|