Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 105594..105848 Replicon plasmid p.E166-P2
Accession NZ_CP032068
Organism Escherichia coli strain E166

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag D2J89_RS24805 Protein ID WP_001312851.1
Coordinates 105699..105848 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 105594..105655 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D2J89_RS24780 (102342) 102342..103088 + 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
D2J89_RS24785 (103147) 103147..104007 + 861 WP_000704513.1 alpha/beta hydrolase -
D2J89_RS24790 (104110) 104110..104670 + 561 WP_000139315.1 fertility inhibition protein FinO -
D2J89_RS24795 (104806) 104806..105018 + 213 WP_001299730.1 ANR family transcriptional regulator -
D2J89_RS24800 (105264) 105264..105338 + 75 Protein_123 endonuclease -
- (105594) 105594..105655 - 62 NuclAT_1 - Antitoxin
- (105594) 105594..105655 - 62 NuclAT_1 - Antitoxin
- (105594) 105594..105655 - 62 NuclAT_1 - Antitoxin
- (105594) 105594..105655 - 62 NuclAT_1 - Antitoxin
D2J89_RS24805 (105699) 105699..105848 + 150 WP_001312851.1 Hok/Gef family protein Toxin
D2J89_RS24810 (106132) 106132..106389 + 258 WP_000083845.1 replication regulatory protein RepA -
D2J89_RS25980 (106406) 106406..106657 - 252 WP_223195197.1 replication protein RepA -
D2J89_RS25985 (106648) 106648..106695 + 48 WP_229471593.1 hypothetical protein -
D2J89_RS24820 (106688) 106688..107170 + 483 WP_001273588.1 hypothetical protein -
D2J89_RS24825 (107163) 107163..108020 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
D2J89_RS24830 (108959) 108959..109612 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
D2J89_RS24835 (109705) 109705..109962 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
D2J89_RS24840 (109895) 109895..110296 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB 1..163224 163224


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T110987 WP_001312851.1 NZ_CP032068:105699-105848 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T110987 NZ_CP032068:105699-105848 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT110987 NZ_CP032068:c105655-105594 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References