Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67516..67785 | Replicon | plasmid p.E166-P2 |
| Accession | NZ_CP032068 | ||
| Organism | Escherichia coli strain E166 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | D2J89_RS24585 | Protein ID | WP_096937776.1 |
| Coordinates | 67660..67785 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 67516..67581 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2J89_RS25965 | 62893..62973 | - | 81 | Protein_71 | hypothetical protein | - |
| D2J89_RS24555 | 63043..63249 | + | 207 | WP_000547969.1 | hypothetical protein | - |
| D2J89_RS24560 | 63275..63814 | + | 540 | WP_001593051.1 | single-stranded DNA-binding protein | - |
| D2J89_RS24565 | 63872..64105 | + | 234 | WP_000005985.1 | DUF905 family protein | - |
| D2J89_RS24570 | 64164..66128 | + | 1965 | WP_001611034.1 | ParB/RepB/Spo0J family partition protein | - |
| D2J89_RS24575 | 66197..66631 | + | 435 | WP_000845962.1 | conjugation system SOS inhibitor PsiB | - |
| D2J89_RS24580 | 66628..67390 | + | 763 | Protein_77 | plasmid SOS inhibition protein A | - |
| - | 67359..67583 | + | 225 | NuclAT_0 | - | - |
| - | 67359..67583 | + | 225 | NuclAT_0 | - | - |
| - | 67359..67583 | + | 225 | NuclAT_0 | - | - |
| - | 67359..67583 | + | 225 | NuclAT_0 | - | - |
| - | 67516..67581 | + | 66 | - | - | Antitoxin |
| D2J89_RS25970 | 67569..67718 | + | 150 | Protein_78 | plasmid maintenance protein Mok | - |
| D2J89_RS24585 | 67660..67785 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D2J89_RS25975 | 68086..68359 | - | 274 | Protein_80 | hypothetical protein | - |
| D2J89_RS24590 | 68411..68707 | + | 297 | WP_001272245.1 | hypothetical protein | - |
| D2J89_RS24595 | 68818..69639 | + | 822 | WP_001234487.1 | DUF932 domain-containing protein | - |
| D2J89_RS24600 | 69936..70526 | - | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| D2J89_RS24605 | 70859..71242 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| D2J89_RS24610 | 71429..72118 | + | 690 | Protein_85 | conjugal transfer transcriptional regulator TraJ | - |
| D2J89_RS24615 | 72211..72612 | + | 402 | WP_001369361.1 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB | 1..163224 | 163224 | |
| - | flank | IS/Tn | - | - | 61751..62722 | 971 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T110983 WP_096937776.1 NZ_CP032068:67660-67785 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
>T110983 NZ_CP032068:67660-67785 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT110983 NZ_CP032068:67516-67581 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|