Detailed information of TA system TA110983

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 67516..67785
• Replicon: plasmid p.E166-P2
• Accession: NZ_CP032068
• Organism: Escherichia coli strain E166

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: D2J89_RS24585
• Protein ID: WP_096937776.1
• Coordinates: 67660..67785 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	67516..67581 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
D2J89_RS25965	62893..62973	-	81	Protein_71	hypothetical protein	-
D2J89_RS24555	63043..63249	+	207	WP_000547969.1	hypothetical protein	-
D2J89_RS24560	63275..63814	+	540	WP_001593051.1	single-stranded DNA-binding protein	-
D2J89_RS24565	63872..64105	+	234	WP_000005985.1	DUF905 family protein	-
D2J89_RS24570	64164..66128	+	1965	WP_001611034.1	ParB/RepB/Spo0J family partition protein	-
D2J89_RS24575	66197..66631	+	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
D2J89_RS24580	66628..67390	+	763	Protein_77	plasmid SOS inhibition protein A	-
-	67359..67583	+	225	NuclAT_0	-	-
-	67359..67583	+	225	NuclAT_0	-	-
-	67359..67583	+	225	NuclAT_0	-	-
-	67359..67583	+	225	NuclAT_0	-	-
-	67516..67581	+	66	-	-	Antitoxin
D2J89_RS25970	67569..67718	+	150	Protein_78	plasmid maintenance protein Mok	-
D2J89_RS24585	67660..67785	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
D2J89_RS25975	68086..68359	-	274	Protein_80	hypothetical protein	-
D2J89_RS24590	68411..68707	+	297	WP_001272245.1	hypothetical protein	-
D2J89_RS24595	68818..69639	+	822	WP_001234487.1	DUF932 domain-containing protein	-
D2J89_RS24600	69936..70526	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
D2J89_RS24605	70859..71242	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
D2J89_RS24610	71429..72118	+	690	Protein_85	conjugal transfer transcriptional regulator TraJ	-
D2J89_RS24615	72211..72612	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2	iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB	1..163224	163224
	-	flank	IS/Tn	-	-	61751..62722	971

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T110983 WP_096937776.1 NZ_CP032068:67660-67785 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T110983 NZ_CP032068:67660-67785 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT110983 NZ_CP032068:67516-67581 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin