Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2464591..2464775 | Replicon | chromosome |
Accession | NZ_CP032051 | ||
Organism | Staphylococcus aureus strain O17 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SaO17_RS12760 | Protein ID | WP_000482647.1 |
Coordinates | 2464668..2464775 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2464591..2464651 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO17_RS12735 | 2460046..2460213 | - | 168 | WP_041204334.1 | hypothetical protein | - |
SaO17_RS12745 | 2460444..2462177 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
SaO17_RS12750 | 2462202..2463965 | - | 1764 | WP_001064817.1 | ABC transporter ATP-binding protein/permease | - |
- | 2464591..2464651 | + | 61 | - | - | Antitoxin |
SaO17_RS12760 | 2464668..2464775 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SaO17_RS12765 | 2464909..2465295 | - | 387 | WP_000779350.1 | flippase GtxA | - |
SaO17_RS12770 | 2465563..2466705 | + | 1143 | WP_118848162.1 | glycerate kinase | - |
SaO17_RS12775 | 2466765..2467424 | + | 660 | WP_000831299.1 | hypothetical protein | - |
SaO17_RS12780 | 2467609..2468820 | + | 1212 | WP_001191928.1 | multidrug effflux MFS transporter | - |
SaO17_RS12785 | 2468943..2469416 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T110945 WP_000482647.1 NZ_CP032051:c2464775-2464668 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T110945 NZ_CP032051:c2464775-2464668 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT110945 NZ_CP032051:2464591-2464651 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|