Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2174398..2174596 | Replicon | chromosome |
Accession | NZ_CP032051 | ||
Organism | Staphylococcus aureus strain O17 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SaO17_RS11220 | Protein ID | WP_001802298.1 |
Coordinates | 2174492..2174596 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2174398..2174436 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SaO17_RS11200 | 2170565..2171230 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
SaO17_RS11205 | 2171382..2171702 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SaO17_RS11210 | 2171704..2172684 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
SaO17_RS11215 | 2172950..2174041 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
- | 2174398..2174436 | + | 39 | - | - | Antitoxin |
SaO17_RS11220 | 2174492..2174596 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SaO17_RS14305 | 2174757..2175240 | - | 484 | Protein_2085 | recombinase family protein | - |
SaO17_RS11230 | 2175283..2176403 | - | 1121 | Protein_2086 | SAP domain-containing protein | - |
SaO17_RS11235 | 2177452..2178309 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
SaO17_RS11240 | 2178377..2179159 | - | 783 | WP_118848146.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T110943 WP_001802298.1 NZ_CP032051:c2174596-2174492 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T110943 NZ_CP032051:c2174596-2174492 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT110943 NZ_CP032051:2174398-2174436 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|