Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2921114..2921334 Replicon chromosome
Accession NZ_CP031908
Organism Escherichia coli O103:H2 strain FWSEC0007

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag CCU04_RS14815 Protein ID WP_000170965.1
Coordinates 2921227..2921334 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2921114..2921180 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCU04_RS14785 2916393..2917787 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
CCU04_RS14790 2917972..2918325 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
CCU04_RS14795 2918369..2919064 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
CCU04_RS14800 2919222..2919452 - 231 WP_001146442.1 putative cation transport regulator ChaB -
CCU04_RS14805 2919722..2920822 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2921114..2921180 - 67 - - Antitoxin
CCU04_RS14815 2921227..2921334 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2921647..2921710 - 64 NuclAT_32 - -
- 2921647..2921710 - 64 NuclAT_32 - -
- 2921647..2921710 - 64 NuclAT_32 - -
- 2921647..2921710 - 64 NuclAT_32 - -
- 2921647..2921710 - 64 NuclAT_34 - -
- 2921647..2921710 - 64 NuclAT_34 - -
- 2921647..2921710 - 64 NuclAT_34 - -
- 2921647..2921710 - 64 NuclAT_34 - -
- 2921647..2921710 - 64 NuclAT_36 - -
- 2921647..2921710 - 64 NuclAT_36 - -
- 2921647..2921710 - 64 NuclAT_36 - -
- 2921647..2921710 - 64 NuclAT_36 - -
- 2921647..2921710 - 64 NuclAT_38 - -
- 2921647..2921710 - 64 NuclAT_38 - -
- 2921647..2921710 - 64 NuclAT_38 - -
- 2921647..2921710 - 64 NuclAT_38 - -
- 2921647..2921710 - 64 NuclAT_40 - -
- 2921647..2921710 - 64 NuclAT_40 - -
- 2921647..2921710 - 64 NuclAT_40 - -
- 2921647..2921710 - 64 NuclAT_40 - -
- 2921647..2921710 - 64 NuclAT_42 - -
- 2921647..2921710 - 64 NuclAT_42 - -
- 2921647..2921710 - 64 NuclAT_42 - -
- 2921647..2921710 - 64 NuclAT_42 - -
- 2921648..2921710 - 63 NuclAT_44 - -
- 2921648..2921710 - 63 NuclAT_44 - -
- 2921648..2921710 - 63 NuclAT_44 - -
- 2921648..2921710 - 63 NuclAT_44 - -
- 2921648..2921710 - 63 NuclAT_47 - -
- 2921648..2921710 - 63 NuclAT_47 - -
- 2921648..2921710 - 63 NuclAT_47 - -
- 2921648..2921710 - 63 NuclAT_47 - -
- 2921648..2921710 - 63 NuclAT_50 - -
- 2921648..2921710 - 63 NuclAT_50 - -
- 2921648..2921710 - 63 NuclAT_50 - -
- 2921648..2921710 - 63 NuclAT_50 - -
- 2921649..2921710 - 62 NuclAT_14 - -
- 2921649..2921710 - 62 NuclAT_14 - -
- 2921649..2921710 - 62 NuclAT_14 - -
- 2921649..2921710 - 62 NuclAT_14 - -
- 2921649..2921710 - 62 NuclAT_17 - -
- 2921649..2921710 - 62 NuclAT_17 - -
- 2921649..2921710 - 62 NuclAT_17 - -
- 2921649..2921710 - 62 NuclAT_17 - -
- 2921649..2921710 - 62 NuclAT_20 - -
- 2921649..2921710 - 62 NuclAT_20 - -
- 2921649..2921710 - 62 NuclAT_20 - -
- 2921649..2921710 - 62 NuclAT_20 - -
- 2921649..2921710 - 62 NuclAT_23 - -
- 2921649..2921710 - 62 NuclAT_23 - -
- 2921649..2921710 - 62 NuclAT_23 - -
- 2921649..2921710 - 62 NuclAT_23 - -
- 2921649..2921710 - 62 NuclAT_26 - -
- 2921649..2921710 - 62 NuclAT_26 - -
- 2921649..2921710 - 62 NuclAT_26 - -
- 2921649..2921710 - 62 NuclAT_26 - -
- 2921649..2921710 - 62 NuclAT_29 - -
- 2921649..2921710 - 62 NuclAT_29 - -
- 2921649..2921710 - 62 NuclAT_29 - -
- 2921649..2921710 - 62 NuclAT_29 - -
CCU04_RS14825 2921763..2921870 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2922184..2922250 - 67 NuclAT_43 - -
- 2922184..2922250 - 67 NuclAT_43 - -
- 2922184..2922250 - 67 NuclAT_43 - -
- 2922184..2922250 - 67 NuclAT_43 - -
- 2922184..2922250 - 67 NuclAT_46 - -
- 2922184..2922250 - 67 NuclAT_46 - -
- 2922184..2922250 - 67 NuclAT_46 - -
- 2922184..2922250 - 67 NuclAT_46 - -
- 2922184..2922250 - 67 NuclAT_49 - -
- 2922184..2922250 - 67 NuclAT_49 - -
- 2922184..2922250 - 67 NuclAT_49 - -
- 2922184..2922250 - 67 NuclAT_49 - -
- 2922185..2922248 - 64 NuclAT_15 - -
- 2922185..2922248 - 64 NuclAT_15 - -
- 2922185..2922248 - 64 NuclAT_15 - -
- 2922185..2922248 - 64 NuclAT_15 - -
- 2922185..2922248 - 64 NuclAT_18 - -
- 2922185..2922248 - 64 NuclAT_18 - -
- 2922185..2922248 - 64 NuclAT_18 - -
- 2922185..2922248 - 64 NuclAT_18 - -
- 2922185..2922248 - 64 NuclAT_21 - -
- 2922185..2922248 - 64 NuclAT_21 - -
- 2922185..2922248 - 64 NuclAT_21 - -
- 2922185..2922248 - 64 NuclAT_21 - -
- 2922185..2922248 - 64 NuclAT_24 - -
- 2922185..2922248 - 64 NuclAT_24 - -
- 2922185..2922248 - 64 NuclAT_24 - -
- 2922185..2922248 - 64 NuclAT_24 - -
- 2922185..2922248 - 64 NuclAT_27 - -
- 2922185..2922248 - 64 NuclAT_27 - -
- 2922185..2922248 - 64 NuclAT_27 - -
- 2922185..2922248 - 64 NuclAT_27 - -
- 2922185..2922248 - 64 NuclAT_30 - -
- 2922185..2922248 - 64 NuclAT_30 - -
- 2922185..2922248 - 64 NuclAT_30 - -
- 2922185..2922248 - 64 NuclAT_30 - -
CCU04_RS14835 2922298..2922405 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
CCU04_RS14840 2922554..2923408 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CCU04_RS14845 2923444..2924253 - 810 WP_001257044.1 invasion regulator SirB1 -
CCU04_RS14850 2924257..2924649 - 393 WP_000200392.1 invasion regulator SirB2 -
CCU04_RS14855 2924646..2925479 - 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T110622 WP_000170965.1 NZ_CP031908:2921227-2921334 [Escherichia coli O103:H2]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T110622 NZ_CP031908:2921227-2921334 [Escherichia coli O103:H2]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT110622 NZ_CP031908:c2921180-2921114 [Escherichia coli O103:H2]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References