Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2085788..2086087 | Replicon | chromosome |
Accession | NZ_CP031890 | ||
Organism | Staphylococcus aureus strain CFSAN082781 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | D1E87_RS10650 | Protein ID | WP_011447039.1 |
Coordinates | 2085911..2086087 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2085788..2085843 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D1E87_RS10605 | 2081255..2081515 | + | 261 | WP_001791826.1 | hypothetical protein | - |
D1E87_RS10610 | 2081568..2081918 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
D1E87_RS10615 | 2082467..2082916 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
D1E87_RS10620 | 2083011..2083346 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
D1E87_RS10630 | 2083996..2084487 | - | 492 | WP_000919350.1 | staphylokinase | - |
D1E87_RS10635 | 2084678..2085433 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
D1E87_RS10640 | 2085445..2085699 | - | 255 | WP_000611512.1 | phage holin | - |
D1E87_RS10645 | 2085751..2085858 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2085780..2085919 | + | 140 | NuclAT_0 | - | - |
- | 2085780..2085919 | + | 140 | NuclAT_0 | - | - |
- | 2085780..2085919 | + | 140 | NuclAT_0 | - | - |
- | 2085780..2085919 | + | 140 | NuclAT_0 | - | - |
- | 2085788..2085843 | + | 56 | - | - | Antitoxin |
D1E87_RS10650 | 2085911..2086087 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
D1E87_RS10655 | 2086237..2086533 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
D1E87_RS10660 | 2086591..2086878 | - | 288 | WP_001040261.1 | hypothetical protein | - |
D1E87_RS10665 | 2086925..2087077 | - | 153 | WP_001153681.1 | hypothetical protein | - |
D1E87_RS10670 | 2087067..2090852 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2081568..2137380 | 55812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T110514 WP_011447039.1 NZ_CP031890:c2086087-2085911 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T110514 NZ_CP031890:c2086087-2085911 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT110514 NZ_CP031890:2085788-2085843 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|