Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2440761..2440945 | Replicon | chromosome |
| Accession | NZ_CP031886 | ||
| Organism | Staphylococcus aureus strain CFSAN082783 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | D1E88_RS12410 | Protein ID | WP_000482647.1 |
| Coordinates | 2440838..2440945 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2440761..2440821 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1E88_RS12395 | 2436347..2436514 | - | 168 | WP_031785511.1 | hypothetical protein | - |
| D1E88_RS12400 | 2436745..2438478 | - | 1734 | WP_149558595.1 | ABC transporter ATP-binding protein/permease | - |
| D1E88_RS12405 | 2438527..2440266 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein/permease | - |
| D1E88_RS14300 | 2440644..2440811 | - | 168 | WP_000301894.1 | hypothetical protein | - |
| - | 2440761..2440821 | + | 61 | - | - | Antitoxin |
| D1E88_RS12410 | 2440838..2440945 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| D1E88_RS12415 | 2441079..2441465 | - | 387 | WP_000779354.1 | flippase GtxA | - |
| D1E88_RS12420 | 2441733..2442875 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
| D1E88_RS12425 | 2442935..2443594 | + | 660 | WP_000831298.1 | membrane protein | - |
| D1E88_RS12430 | 2443774..2444985 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
| D1E88_RS12435 | 2445108..2445581 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T110492 WP_000482647.1 NZ_CP031886:c2440945-2440838 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T110492 NZ_CP031886:c2440945-2440838 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT110492 NZ_CP031886:2440761-2440821 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|