Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69401..69654 | Replicon | plasmid pKP121-3 |
| Accession | NZ_CP031852 | ||
| Organism | Klebsiella pneumoniae strain 121 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | D1Y71_RS28555 | Protein ID | WP_001312851.1 |
| Coordinates | 69505..69654 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 69401..69460 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1Y71_RS28510 | 64579..65040 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| D1Y71_RS28515 | 65086..65295 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| D1Y71_RS28520 | 65333..65923 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| D1Y71_RS28525 | 66110..67681 | - | 1572 | WP_001526014.1 | IS66 family transposase | - |
| D1Y71_RS28530 | 67701..68048 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| D1Y71_RS28535 | 68048..68725 | - | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| D1Y71_RS28545 | 68785..69258 | + | 474 | WP_016240489.1 | hypothetical protein | - |
| - | 69401..69460 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 69401..69460 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 69401..69460 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 69401..69460 | - | 60 | NuclAT_1 | - | Antitoxin |
| D1Y71_RS28555 | 69505..69654 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D1Y71_RS28560 | 69939..70187 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..70498 | 70498 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T110373 WP_001312851.1 NZ_CP031852:69505-69654 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T110373 NZ_CP031852:69505-69654 [Klebsiella pneumoniae]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT110373 NZ_CP031852:c69460-69401 [Klebsiella pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|