Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 25368..25637 | Replicon | plasmid pKP121-3 |
Accession | NZ_CP031852 | ||
Organism | Klebsiella pneumoniae strain 121 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | D1Y71_RS28275 | Protein ID | WP_001312861.1 |
Coordinates | 25479..25637 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 25368..25433 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D1Y71_RS28250 | 21137..21664 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
D1Y71_RS28255 | 21722..21955 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
D1Y71_RS28260 | 22016..23980 | + | 1965 | WP_025746229.1 | ParB/RepB/Spo0J family partition protein | - |
D1Y71_RS28265 | 24049..24483 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
D1Y71_RS28270 | 24480..25199 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 25211..25435 | + | 225 | NuclAT_0 | - | - |
- | 25211..25435 | + | 225 | NuclAT_0 | - | - |
- | 25211..25435 | + | 225 | NuclAT_0 | - | - |
- | 25211..25435 | + | 225 | NuclAT_0 | - | - |
- | 25368..25433 | + | 66 | - | - | Antitoxin |
D1Y71_RS28275 | 25479..25637 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
D1Y71_RS28280 | 25938..26142 | - | 205 | Protein_34 | pilus protein | - |
D1Y71_RS28290 | 26534..26830 | + | 297 | WP_001272251.1 | hypothetical protein | - |
D1Y71_RS28295 | 26941..27762 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
D1Y71_RS28300 | 28059..28649 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
D1Y71_RS28305 | 28982..29365 | + | 384 | WP_001151529.1 | relaxosome protein TraM | - |
D1Y71_RS28310 | 29558..30205 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
D1Y71_RS28315 | 30313..30552 | + | 240 | WP_042018283.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..70498 | 70498 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T110370 WP_001312861.1 NZ_CP031852:25479-25637 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T110370 NZ_CP031852:25479-25637 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT110370 NZ_CP031852:25368-25433 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|