Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 871999..872179 | Replicon | chromosome |
Accession | NZ_CP031839 | ||
Organism | Staphylococcus aureus strain NX-T55 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | D1O27_RS04785 | Protein ID | WP_001801861.1 |
Coordinates | 872084..872179 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 871999..872056 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D1O27_RS04765 | 867574..868254 | + | 681 | Protein_848 | DNA adenine methylase | - |
D1O27_RS04770 | 868306..869478 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
D1O27_RS04780 | 869738..871433 | + | 1696 | Protein_850 | hypothetical protein | - |
- | 871999..872056 | + | 58 | - | - | Antitoxin |
D1O27_RS04785 | 872084..872179 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
D1O27_RS04795 | 872631..873077 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
D1O27_RS04800 | 873261..873817 | + | 557 | Protein_853 | ImmA/IrrE family metallo-endopeptidase | - |
D1O27_RS04805 | 873949..874701 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
D1O27_RS04810 | 874728..875471 | - | 744 | WP_175393121.1 | exotoxin | - |
D1O27_RS04815 | 875498..876124 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 849383..877888 | 28505 | |
- | flank | IS/Tn | - | - | 868306..869478 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T110300 WP_001801861.1 NZ_CP031839:c872179-872084 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T110300 NZ_CP031839:c872179-872084 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT110300 NZ_CP031839:871999-872056 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|