Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 296361..296545 | Replicon | chromosome |
Accession | NZ_CP031839 | ||
Organism | Staphylococcus aureus strain NX-T55 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | D1O27_RS01525 | Protein ID | WP_000482647.1 |
Coordinates | 296361..296468 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 296485..296545 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D1O27_RS01500 | 291733..292206 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
D1O27_RS01505 | 292329..293540 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
D1O27_RS01510 | 293722..294381 | - | 660 | WP_000831298.1 | membrane protein | - |
D1O27_RS01515 | 294441..295583 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
D1O27_RS01520 | 295841..296227 | + | 387 | WP_000779360.1 | flippase GtxA | - |
D1O27_RS01525 | 296361..296468 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 296485..296545 | - | 61 | - | - | Antitoxin |
D1O27_RS01535 | 297096..298859 | + | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
D1O27_RS01540 | 298884..300617 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
D1O27_RS01550 | 300848..301015 | + | 168 | WP_117346041.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T110290 WP_000482647.1 NZ_CP031839:296361-296468 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T110290 NZ_CP031839:296361-296468 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT110290 NZ_CP031839:c296545-296485 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|