Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 938336..938516 | Replicon | chromosome |
Accession | NZ_CP031838 | ||
Organism | Staphylococcus aureus strain QD-CD9 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | D1G35_RS05065 | Protein ID | WP_001801861.1 |
Coordinates | 938421..938516 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 938336..938393 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D1G35_RS05045 | 933911..934591 | + | 681 | Protein_902 | DNA adenine methylase | - |
D1G35_RS05050 | 934643..935815 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
D1G35_RS05060 | 936075..937770 | + | 1696 | Protein_904 | hypothetical protein | - |
- | 938336..938393 | + | 58 | - | - | Antitoxin |
D1G35_RS05065 | 938421..938516 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
D1G35_RS05075 | 938968..939414 | + | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
D1G35_RS05080 | 939598..940154 | + | 557 | Protein_907 | ImmA/IrrE family metallo-endopeptidase | - |
D1G35_RS05085 | 940286..941038 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
D1G35_RS05090 | 941065..941808 | - | 744 | WP_175393121.1 | exotoxin | - |
D1G35_RS05095 | 941835..942461 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 914388..945020 | 30632 | |
- | flank | IS/Tn | - | - | 934643..935815 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T110283 WP_001801861.1 NZ_CP031838:c938516-938421 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T110283 NZ_CP031838:c938516-938421 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT110283 NZ_CP031838:938336-938393 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|