Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28234..28503 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP031804 | ||
| Organism | Klebsiella pneumoniae strain MSB1_8A-sc-2280397 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | D0887_RS32705 | Protein ID | WP_001312861.1 |
| Coordinates | 28345..28503 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 28234..28299 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0887_RS30395 | 24003..24530 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| D0887_RS30400 | 24588..24821 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| D0887_RS30405 | 24882..26846 | + | 1965 | WP_117389470.1 | ParB/RepB/Spo0J family partition protein | - |
| D0887_RS30410 | 26915..27349 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| D0887_RS30415 | 27346..28065 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 28077..28301 | + | 225 | NuclAT_0 | - | - |
| - | 28077..28301 | + | 225 | NuclAT_0 | - | - |
| - | 28077..28301 | + | 225 | NuclAT_0 | - | - |
| - | 28077..28301 | + | 225 | NuclAT_0 | - | - |
| - | 28234..28299 | + | 66 | - | - | Antitoxin |
| D0887_RS32705 | 28345..28503 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| D0887_RS32710 | 28804..29008 | - | 205 | Protein_38 | pilus protein | - |
| D0887_RS30435 | 29400..29696 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| D0887_RS30440 | 29807..30628 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| D0887_RS30445 | 30925..31515 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| D0887_RS30450 | 31848..32231 | + | 384 | WP_001151529.1 | relaxosome protein TraM | - |
| D0887_RS30455 | 32423..33070 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
| D0887_RS30460 | 33178..33417 | + | 240 | WP_042018283.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) | - | 1..70656 | 70656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T110176 WP_001312861.1 NZ_CP031804:28345-28503 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T110176 NZ_CP031804:28345-28503 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT110176 NZ_CP031804:28234-28299 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|