Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59989..60242 | Replicon | plasmid pVirR1 |
| Accession | NZ_CP031707 | ||
| Organism | Escherichia coli strain R1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | D0T88_RS24495 | Protein ID | WP_001312851.1 |
| Coordinates | 59989..60138 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60183..60242 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0T88_RS24450 | 55210..55461 | - | 252 | WP_042004542.1 | hypothetical protein | - |
| D0T88_RS24455 | 55442..55681 | - | 240 | WP_042004543.1 | hypothetical protein | - |
| D0T88_RS24460 | 56134..56394 | - | 261 | Protein_47 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| D0T88_RS24465 | 56412..56681 | - | 270 | WP_000079930.1 | hypothetical protein | - |
| D0T88_RS24470 | 56736..56894 | - | 159 | WP_063113284.1 | hypothetical protein | - |
| D0T88_RS24475 | 57601..58623 | - | 1023 | WP_063113283.1 | replication initiation protein | - |
| D0T88_RS24480 | 58613..59146 | - | 534 | WP_063113282.1 | replication protein | - |
| D0T88_RS24485 | 59139..59216 | - | 78 | WP_063113289.1 | RepA leader peptide Tap | - |
| D0T88_RS24490 | 59448..59705 | - | 258 | WP_021553168.1 | replication regulatory protein RepA | - |
| D0T88_RS24495 | 59989..60138 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 60183..60242 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 60183..60242 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 60183..60242 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 60183..60242 | + | 60 | NuclAT_0 | - | Antitoxin |
| D0T88_RS24500 | 60385..60858 | - | 474 | WP_063113281.1 | hypothetical protein | - |
| D0T88_RS24505 | 61012..61602 | - | 591 | Protein_56 | DUF2726 domain-containing protein | - |
| D0T88_RS24510 | 61649..63187 | - | 1539 | WP_137546056.1 | IS66-like element ISEc8 family transposase | - |
| D0T88_RS24515 | 63237..63584 | - | 348 | WP_000612591.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| D0T88_RS24520 | 63581..63961 | - | 381 | WP_001171554.1 | IS66 family insertion sequence hypothetical protein | - |
| D0T88_RS24525 | 64091..64300 | - | 210 | WP_063113249.1 | hemolysin expression modulator Hha | - |
| D0T88_RS24530 | 64346..64807 | - | 462 | WP_063113250.1 | thermonuclease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | cnf1 / hlyD / hlyB / hlyA / hlyC | 1..127578 | 127578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T109915 WP_001312851.1 NZ_CP031707:c60138-59989 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T109915 NZ_CP031707:c60138-59989 [Escherichia coli]
ATGACGAAATATGCCCTTATAGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATAGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT109915 NZ_CP031707:60183-60242 [Escherichia coli]
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
AACGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|