Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1946054..1946275 Replicon chromosome
Accession NZ_CP031706
Organism Escherichia coli strain R1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag D0T88_RS09355 Protein ID WP_000170954.1
Coordinates 1946054..1946161 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1946209..1946275 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D0T88_RS09330 1941898..1942980 + 1083 WP_000804726.1 peptide chain release factor 1 -
D0T88_RS09335 1942980..1943813 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
D0T88_RS09340 1943810..1944202 + 393 WP_000200378.1 invasion regulator SirB2 -
D0T88_RS09345 1944206..1945015 + 810 WP_001257044.1 invasion regulator SirB1 -
D0T88_RS09350 1945051..1945905 + 855 WP_063113747.1 3-deoxy-8-phosphooctulonate synthase -
D0T88_RS09355 1946054..1946161 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1946209..1946275 + 67 NuclAT_27 - Antitoxin
- 1946209..1946275 + 67 NuclAT_27 - Antitoxin
- 1946209..1946275 + 67 NuclAT_27 - Antitoxin
- 1946209..1946275 + 67 NuclAT_27 - Antitoxin
- 1946209..1946275 + 67 NuclAT_29 - Antitoxin
- 1946209..1946275 + 67 NuclAT_29 - Antitoxin
- 1946209..1946275 + 67 NuclAT_29 - Antitoxin
- 1946209..1946275 + 67 NuclAT_29 - Antitoxin
- 1946209..1946275 + 67 NuclAT_31 - Antitoxin
- 1946209..1946275 + 67 NuclAT_31 - Antitoxin
- 1946209..1946275 + 67 NuclAT_31 - Antitoxin
- 1946209..1946275 + 67 NuclAT_31 - Antitoxin
- 1946209..1946275 + 67 NuclAT_33 - Antitoxin
- 1946209..1946275 + 67 NuclAT_33 - Antitoxin
- 1946209..1946275 + 67 NuclAT_33 - Antitoxin
- 1946209..1946275 + 67 NuclAT_33 - Antitoxin
- 1946209..1946275 + 67 NuclAT_35 - Antitoxin
- 1946209..1946275 + 67 NuclAT_35 - Antitoxin
- 1946209..1946275 + 67 NuclAT_35 - Antitoxin
- 1946209..1946275 + 67 NuclAT_35 - Antitoxin
- 1946209..1946275 + 67 NuclAT_37 - Antitoxin
- 1946209..1946275 + 67 NuclAT_37 - Antitoxin
- 1946209..1946275 + 67 NuclAT_37 - Antitoxin
- 1946209..1946275 + 67 NuclAT_37 - Antitoxin
- 1946211..1946274 + 64 NuclAT_40 - -
- 1946211..1946274 + 64 NuclAT_40 - -
- 1946211..1946274 + 64 NuclAT_40 - -
- 1946211..1946274 + 64 NuclAT_40 - -
- 1946211..1946274 + 64 NuclAT_42 - -
- 1946211..1946274 + 64 NuclAT_42 - -
- 1946211..1946274 + 64 NuclAT_42 - -
- 1946211..1946274 + 64 NuclAT_42 - -
D0T88_RS09360 1946589..1946696 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1946749..1946810 + 62 NuclAT_39 - -
- 1946749..1946810 + 62 NuclAT_39 - -
- 1946749..1946810 + 62 NuclAT_39 - -
- 1946749..1946810 + 62 NuclAT_39 - -
- 1946749..1946810 + 62 NuclAT_41 - -
- 1946749..1946810 + 62 NuclAT_41 - -
- 1946749..1946810 + 62 NuclAT_41 - -
- 1946749..1946810 + 62 NuclAT_41 - -
- 1946749..1946811 + 63 NuclAT_28 - -
- 1946749..1946811 + 63 NuclAT_28 - -
- 1946749..1946811 + 63 NuclAT_28 - -
- 1946749..1946811 + 63 NuclAT_28 - -
- 1946749..1946811 + 63 NuclAT_30 - -
- 1946749..1946811 + 63 NuclAT_30 - -
- 1946749..1946811 + 63 NuclAT_30 - -
- 1946749..1946811 + 63 NuclAT_30 - -
- 1946749..1946811 + 63 NuclAT_32 - -
- 1946749..1946811 + 63 NuclAT_32 - -
- 1946749..1946811 + 63 NuclAT_32 - -
- 1946749..1946811 + 63 NuclAT_32 - -
- 1946749..1946811 + 63 NuclAT_34 - -
- 1946749..1946811 + 63 NuclAT_34 - -
- 1946749..1946811 + 63 NuclAT_34 - -
- 1946749..1946811 + 63 NuclAT_34 - -
- 1946749..1946811 + 63 NuclAT_36 - -
- 1946749..1946811 + 63 NuclAT_36 - -
- 1946749..1946811 + 63 NuclAT_36 - -
- 1946749..1946811 + 63 NuclAT_36 - -
- 1946749..1946811 + 63 NuclAT_38 - -
- 1946749..1946811 + 63 NuclAT_38 - -
- 1946749..1946811 + 63 NuclAT_38 - -
- 1946749..1946811 + 63 NuclAT_38 - -
- 1946749..1946812 + 64 NuclAT_16 - -
- 1946749..1946812 + 64 NuclAT_16 - -
- 1946749..1946812 + 64 NuclAT_16 - -
- 1946749..1946812 + 64 NuclAT_16 - -
- 1946749..1946812 + 64 NuclAT_18 - -
- 1946749..1946812 + 64 NuclAT_18 - -
- 1946749..1946812 + 64 NuclAT_18 - -
- 1946749..1946812 + 64 NuclAT_18 - -
- 1946749..1946812 + 64 NuclAT_20 - -
- 1946749..1946812 + 64 NuclAT_20 - -
- 1946749..1946812 + 64 NuclAT_20 - -
- 1946749..1946812 + 64 NuclAT_20 - -
- 1946749..1946812 + 64 NuclAT_22 - -
- 1946749..1946812 + 64 NuclAT_22 - -
- 1946749..1946812 + 64 NuclAT_22 - -
- 1946749..1946812 + 64 NuclAT_22 - -
- 1946749..1946812 + 64 NuclAT_24 - -
- 1946749..1946812 + 64 NuclAT_24 - -
- 1946749..1946812 + 64 NuclAT_24 - -
- 1946749..1946812 + 64 NuclAT_24 - -
- 1946749..1946812 + 64 NuclAT_26 - -
- 1946749..1946812 + 64 NuclAT_26 - -
- 1946749..1946812 + 64 NuclAT_26 - -
- 1946749..1946812 + 64 NuclAT_26 - -
D0T88_RS09365 1947125..1947232 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1947280..1947347 + 68 NuclAT_15 - -
- 1947280..1947347 + 68 NuclAT_15 - -
- 1947280..1947347 + 68 NuclAT_15 - -
- 1947280..1947347 + 68 NuclAT_15 - -
- 1947280..1947347 + 68 NuclAT_17 - -
- 1947280..1947347 + 68 NuclAT_17 - -
- 1947280..1947347 + 68 NuclAT_17 - -
- 1947280..1947347 + 68 NuclAT_17 - -
- 1947280..1947347 + 68 NuclAT_19 - -
- 1947280..1947347 + 68 NuclAT_19 - -
- 1947280..1947347 + 68 NuclAT_19 - -
- 1947280..1947347 + 68 NuclAT_19 - -
- 1947280..1947347 + 68 NuclAT_21 - -
- 1947280..1947347 + 68 NuclAT_21 - -
- 1947280..1947347 + 68 NuclAT_21 - -
- 1947280..1947347 + 68 NuclAT_21 - -
- 1947280..1947347 + 68 NuclAT_23 - -
- 1947280..1947347 + 68 NuclAT_23 - -
- 1947280..1947347 + 68 NuclAT_23 - -
- 1947280..1947347 + 68 NuclAT_23 - -
- 1947280..1947347 + 68 NuclAT_25 - -
- 1947280..1947347 + 68 NuclAT_25 - -
- 1947280..1947347 + 68 NuclAT_25 - -
- 1947280..1947347 + 68 NuclAT_25 - -
D0T88_RS09370 1947637..1948737 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
D0T88_RS09375 1949007..1949237 + 231 WP_001146444.1 putative cation transport regulator ChaB -
D0T88_RS09380 1949395..1950090 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
D0T88_RS09385 1950134..1950487 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T109896 WP_000170954.1 NZ_CP031706:c1946161-1946054 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T109896 NZ_CP031706:c1946161-1946054 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT109896 NZ_CP031706:1946209-1946275 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References