Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1946054..1946275 | Replicon | chromosome |
| Accession | NZ_CP031706 | ||
| Organism | Escherichia coli strain R1 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | D0T88_RS09355 | Protein ID | WP_000170954.1 |
| Coordinates | 1946054..1946161 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1946209..1946275 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0T88_RS09330 | 1941898..1942980 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| D0T88_RS09335 | 1942980..1943813 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| D0T88_RS09340 | 1943810..1944202 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| D0T88_RS09345 | 1944206..1945015 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| D0T88_RS09350 | 1945051..1945905 | + | 855 | WP_063113747.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| D0T88_RS09355 | 1946054..1946161 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1946209..1946275 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1946209..1946275 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1946211..1946274 | + | 64 | NuclAT_40 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_40 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_40 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_40 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_42 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_42 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_42 | - | - |
| - | 1946211..1946274 | + | 64 | NuclAT_42 | - | - |
| D0T88_RS09360 | 1946589..1946696 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1946749..1946810 | + | 62 | NuclAT_39 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_39 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_39 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_39 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_41 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_41 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_41 | - | - |
| - | 1946749..1946810 | + | 62 | NuclAT_41 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_28 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_28 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_28 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_28 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_30 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_30 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_30 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_30 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_32 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_32 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_32 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_32 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_34 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_34 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_34 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_34 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_36 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_36 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_36 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_36 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_38 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_38 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_38 | - | - |
| - | 1946749..1946811 | + | 63 | NuclAT_38 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_16 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_16 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_16 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_16 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_18 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_18 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_18 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_18 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_20 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_20 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_20 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_20 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_22 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_22 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_22 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_22 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_24 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_24 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_24 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_24 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_26 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_26 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_26 | - | - |
| - | 1946749..1946812 | + | 64 | NuclAT_26 | - | - |
| D0T88_RS09365 | 1947125..1947232 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1947280..1947347 | + | 68 | NuclAT_15 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_15 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_15 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_15 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_17 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_17 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_17 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_17 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_19 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_19 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_19 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_19 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_21 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_21 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_21 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_21 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_23 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_23 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_23 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_23 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_25 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_25 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_25 | - | - |
| - | 1947280..1947347 | + | 68 | NuclAT_25 | - | - |
| D0T88_RS09370 | 1947637..1948737 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| D0T88_RS09375 | 1949007..1949237 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| D0T88_RS09380 | 1949395..1950090 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| D0T88_RS09385 | 1950134..1950487 | - | 354 | WP_001169671.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T109896 WP_000170954.1 NZ_CP031706:c1946161-1946054 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T109896 NZ_CP031706:c1946161-1946054 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT109896 NZ_CP031706:1946209-1946275 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|