Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1100788..1100970 | Replicon | chromosome |
Accession | NZ_CP031673 | ||
Organism | Staphylococcus aureus strain MOZ66 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DD548_RS06085 | Protein ID | WP_001801861.1 |
Coordinates | 1100875..1100970 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1100788..1100847 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD548_RS06070 | 1099926..1100303 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
DD548_RS06075 | 1100497..1100673 | + | 177 | Protein_1100 | transposase | - |
DD548_RS06080 | 1100651..1100752 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 1100788..1100847 | + | 60 | - | - | Antitoxin |
DD548_RS06085 | 1100875..1100970 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
DD548_RS06095 | 1101173..1101316 | + | 144 | WP_001549059.1 | transposase | - |
DD548_RS06105 | 1101920..1102303 | + | 384 | WP_000070812.1 | hypothetical protein | - |
DD548_RS06110 | 1102314..1102490 | + | 177 | WP_000375476.1 | hypothetical protein | - |
DD548_RS06115 | 1102492..1102677 | + | 186 | WP_000809857.1 | hypothetical protein | - |
DD548_RS06120 | 1102791..1103432 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DD548_RS06125 | 1103650..1104201 | - | 552 | WP_000414205.1 | hypothetical protein | - |
DD548_RS06130 | 1104299..1104643 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
DD548_RS06135 | 1104684..1105310 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T109751 WP_001801861.1 NZ_CP031673:c1100970-1100875 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T109751 NZ_CP031673:c1100970-1100875 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT109751 NZ_CP031673:1100788-1100847 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|