Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 411368..411552 | Replicon | chromosome |
Accession | NZ_CP031673 | ||
Organism | Staphylococcus aureus strain MOZ66 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | DD548_RS01960 | Protein ID | WP_000482650.1 |
Coordinates | 411368..411475 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 411492..411552 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD548_RS01935 | 406730..407203 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
DD548_RS01940 | 407326..408537 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
DD548_RS01945 | 408719..409378 | - | 660 | WP_000831298.1 | membrane protein | - |
DD548_RS01950 | 409438..410580 | - | 1143 | Protein_366 | glycerate kinase | - |
DD548_RS01955 | 410848..411234 | + | 387 | WP_000779358.1 | flippase GtxA | - |
DD548_RS01960 | 411368..411475 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 411492..411552 | - | 61 | - | - | Antitoxin |
DD548_RS01970 | 412103..413866 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
DD548_RS01975 | 413891..415624 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
DD548_RS01985 | 415855..416022 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T109737 WP_000482650.1 NZ_CP031673:411368-411475 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T109737 NZ_CP031673:411368-411475 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT109737 NZ_CP031673:c411552-411492 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|