Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1967010..1967192 | Replicon | chromosome |
| Accession | NZ_CP031670 | ||
| Organism | Staphylococcus aureus strain 64 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | DD547_RS10155 | Protein ID | WP_001801861.1 |
| Coordinates | 1967010..1967105 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1967133..1967192 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DD547_RS10105 | 1962670..1963296 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| DD547_RS10110 | 1963337..1963681 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| DD547_RS10115 | 1963779..1964330 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| DD547_RS10120 | 1964548..1965189 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DD547_RS10125 | 1965303..1965488 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| DD547_RS10130 | 1965490..1965666 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| DD547_RS10135 | 1965677..1966060 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| DD547_RS10145 | 1966664..1966807 | - | 144 | WP_001549059.1 | transposase | - |
| DD547_RS10155 | 1967010..1967105 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1967133..1967192 | - | 60 | - | - | Antitoxin |
| DD547_RS10160 | 1967228..1967329 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| DD547_RS10165 | 1967307..1967483 | - | 177 | Protein_1922 | transposase | - |
| DD547_RS10170 | 1967677..1968054 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1940984..2018744 | 77760 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T109725 WP_001801861.1 NZ_CP031670:1967010-1967105 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T109725 NZ_CP031670:1967010-1967105 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT109725 NZ_CP031670:c1967192-1967133 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|