Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2028721..2029020 | Replicon | chromosome |
Accession | NZ_CP031664 | ||
Organism | Staphylococcus aureus strain 28 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | DD545_RS10495 | Protein ID | WP_072353918.1 |
Coordinates | 2028844..2029020 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2028721..2028776 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD545_RS10435 | 2024279..2024458 | + | 180 | WP_000669791.1 | hypothetical protein | - |
DD545_RS10445 | 2024769..2025029 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DD545_RS10450 | 2025082..2025432 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DD545_RS10455 | 2025943..2026278 | - | 336 | Protein_1931 | SH3 domain-containing protein | - |
DD545_RS10475 | 2026929..2027420 | - | 492 | WP_000920038.1 | staphylokinase | - |
DD545_RS10480 | 2027611..2028366 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DD545_RS10485 | 2028378..2028632 | - | 255 | WP_000611512.1 | phage holin | - |
DD545_RS10490 | 2028684..2028791 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2028713..2028852 | + | 140 | NuclAT_0 | - | - |
- | 2028713..2028852 | + | 140 | NuclAT_0 | - | - |
- | 2028713..2028852 | + | 140 | NuclAT_0 | - | - |
- | 2028713..2028852 | + | 140 | NuclAT_0 | - | - |
- | 2028721..2028776 | + | 56 | - | - | Antitoxin |
DD545_RS10495 | 2028844..2029020 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
DD545_RS10500 | 2029163..2029537 | - | 375 | WP_000340977.1 | hypothetical protein | - |
DD545_RS10505 | 2029593..2029880 | - | 288 | WP_001262620.1 | hypothetical protein | - |
DD545_RS10510 | 2029926..2030078 | - | 153 | WP_001000058.1 | hypothetical protein | - |
DD545_RS10515 | 2030071..2033853 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / sell / sec / groEL | 2025082..2095474 | 70392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T109687 WP_072353918.1 NZ_CP031664:c2029020-2028844 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T109687 NZ_CP031664:c2029020-2028844 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT109687 NZ_CP031664:2028721-2028776 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|