Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25833..26097 | Replicon | plasmid pZYST1C2 |
| Accession | NZ_CP031615 | ||
| Organism | Klebsiella pneumoniae strain ZYST1 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | DWV03_RS27655 | Protein ID | WP_001303307.1 |
| Coordinates | 25945..26097 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 25833..25895 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWV03_RS27640 | 21935..23005 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| DWV03_RS27645 | 23024..24232 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 24412..24472 | - | 61 | NuclAT_1 | - | - |
| - | 24412..24472 | - | 61 | NuclAT_1 | - | - |
| - | 24412..24472 | - | 61 | NuclAT_1 | - | - |
| - | 24412..24472 | - | 61 | NuclAT_1 | - | - |
| DWV03_RS27650 | 24539..25630 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 25833..25895 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 25833..25895 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 25833..25895 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 25833..25895 | - | 63 | NuclAT_0 | - | Antitoxin |
| DWV03_RS27655 | 25945..26097 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| DWV03_RS29575 | 26462..26794 | + | 333 | WP_162888547.1 | hypothetical protein | - |
| - | 26810..26862 | - | 53 | NuclAT_2 | - | - |
| - | 26810..26862 | - | 53 | NuclAT_2 | - | - |
| - | 26810..26862 | - | 53 | NuclAT_2 | - | - |
| - | 26810..26862 | - | 53 | NuclAT_2 | - | - |
| DWV03_RS29580 | 27357..27533 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| DWV03_RS27665 | 27742..27952 | - | 211 | Protein_34 | hemolysin expression modulator Hha | - |
| DWV03_RS27670 | 28050..28664 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| DWV03_RS27675 | 28740..30908 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / erm(B) | - | 1..107458 | 107458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T109564 WP_001303307.1 NZ_CP031615:25945-26097 [Klebsiella pneumoniae]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T109564 NZ_CP031615:25945-26097 [Klebsiella pneumoniae]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT109564 NZ_CP031615:c25895-25833 [Klebsiella pneumoniae]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|