Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 926923..927140 | Replicon | chromosome |
| Accession | NZ_CP031537 | ||
| Organism | Staphylococcus aureus strain WCH-SK2 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | LR49_RS05060 | Protein ID | WP_001802298.1 |
| Coordinates | 927036..927140 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 926923..926978 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LR49_RS05040 | 923183..923848 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| LR49_RS05045 | 924000..924320 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| LR49_RS05050 | 924322..925302 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| LR49_RS05055 | 925568..926659 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 926923..926978 | + | 56 | - | - | Antitoxin |
| LR49_RS05060 | 927036..927140 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| LR49_RS15280 | 927301..927784 | - | 484 | Protein_913 | recombinase family protein | - |
| LR49_RS05070 | 927827..928963 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| LR49_RS05075 | 929252..929344 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| LR49_RS05080 | 930049..930906 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| LR49_RS05085 | 930974..931756 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T109335 WP_001802298.1 NZ_CP031537:c927140-927036 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T109335 NZ_CP031537:c927140-927036 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT109335 NZ_CP031537:926923-926978 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|