Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 575456..575638 | Replicon | chromosome |
| Accession | NZ_CP031537 | ||
| Organism | Staphylococcus aureus strain WCH-SK2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | LR49_RS02865 | Protein ID | WP_001801861.1 |
| Coordinates | 575456..575551 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 575579..575638 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LR49_RS02815 | 571116..571742 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| LR49_RS02820 | 571783..572127 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| LR49_RS02825 | 572225..572776 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| LR49_RS02830 | 572994..573635 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LR49_RS02835 | 573749..573934 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| LR49_RS02840 | 573936..574112 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| LR49_RS02845 | 574123..574506 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| LR49_RS02855 | 575110..575253 | - | 144 | WP_001549059.1 | transposase | - |
| LR49_RS02865 | 575456..575551 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 575579..575638 | - | 60 | - | - | Antitoxin |
| LR49_RS02870 | 575674..575775 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| LR49_RS02875 | 575753..575929 | - | 177 | Protein_544 | transposase | - |
| LR49_RS02880 | 576123..576500 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T109323 WP_001801861.1 NZ_CP031537:575456-575551 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T109323 NZ_CP031537:575456-575551 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT109323 NZ_CP031537:c575638-575579 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|