Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 228029..228283 | Replicon | plasmid pGD31-F1928 |
| Accession | NZ_CP031295 | ||
| Organism | Escherichia coli strain EC17GD31 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | DWB25_RS26095 | Protein ID | WP_001351576.1 |
| Coordinates | 228077..228283 (+) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 228029..228090 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWB25_RS26075 | 225982..226725 | + | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
| DWB25_RS26080 | 226780..227340 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| DWB25_RS26085 | 227475..227687 | + | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| - | 228029..228090 | - | 62 | NuclAT_2 | - | Antitoxin |
| - | 228029..228090 | - | 62 | NuclAT_2 | - | Antitoxin |
| - | 228029..228090 | - | 62 | NuclAT_2 | - | Antitoxin |
| - | 228029..228090 | - | 62 | NuclAT_2 | - | Antitoxin |
| DWB25_RS26095 | 228077..228283 | + | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| DWB25_RS26100 | 228551..228808 | + | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| DWB25_RS26110 | 229040..229114 | + | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
| DWB25_RS26115 | 229107..229964 | + | 858 | WP_039002220.1 | incFII family plasmid replication initiator RepA | - |
| DWB25_RS26130 | 230930..231181 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| DWB25_RS26135 | 231178..231465 | + | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DWB25_RS26140 | 231540..231728 | - | 189 | Protein_265 | IS3 family transposase | - |
| DWB25_RS26145 | 231762..232262 | - | 501 | Protein_266 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul3 / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / tet(A) / aph(3')-Ia / sitABCD / blaTEM-1B | iucA / iucB / iucC / iucD / iutA | 1..245305 | 245305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T108877 WP_001351576.1 NZ_CP031295:228077-228283 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T108877 NZ_CP031295:228077-228283 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT108877 NZ_CP031295:c228090-228029 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|