Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 126765..127019 | Replicon | plasmid pGD31-F1928 |
Accession | NZ_CP031295 | ||
Organism | Escherichia coli strain EC17GD31 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | DWB25_RS25470 | Protein ID | WP_001351576.1 |
Coordinates | 126813..127019 (+) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 126765..126826 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DWB25_RS25445 | 123513..124259 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
DWB25_RS25450 | 124318..125178 | + | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
DWB25_RS25455 | 125281..125841 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
DWB25_RS25460 | 125977..126189 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
DWB25_RS28105 | 126435..126509 | + | 75 | Protein_144 | endonuclease | - |
- | 126765..126826 | - | 62 | NuclAT_3 | - | Antitoxin |
- | 126765..126826 | - | 62 | NuclAT_3 | - | Antitoxin |
- | 126765..126826 | - | 62 | NuclAT_3 | - | Antitoxin |
- | 126765..126826 | - | 62 | NuclAT_3 | - | Antitoxin |
DWB25_RS25470 | 126813..127019 | + | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DWB25_RS25475 | 127303..127560 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
DWB25_RS25485 | 127792..127866 | + | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
DWB25_RS25490 | 127859..128341 | + | 483 | WP_001273588.1 | hypothetical protein | - |
DWB25_RS25495 | 128334..129191 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
DWB25_RS27925 | 129892..130032 | + | 141 | WP_001333237.1 | hypothetical protein | - |
DWB25_RS25505 | 130130..130780 | + | 651 | WP_127070541.1 | CPBP family intramembrane metalloprotease | - |
DWB25_RS25510 | 130873..131130 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
DWB25_RS25515 | 131063..131464 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul3 / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / tet(A) / aph(3')-Ia / sitABCD / blaTEM-1B | iucA / iucB / iucC / iucD / iutA | 1..245305 | 245305 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T108868 WP_001351576.1 NZ_CP031295:126813-127019 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T108868 NZ_CP031295:126813-127019 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCTTTGCTGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT108868 NZ_CP031295:c126826-126765 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|